Carg18533 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTTCTAAATTCATCACCTTTCTCTGCCTAATCTTCCTCCTCCTCCTCTCCAACAGCCCGTCTGCCTACGCTGCCCGCCCCGTTCCCACCGTTTCATCCGATGCACCAGCTACCCAAATCCCAAATCAGGTTCGTTAACAAATTTATCAATAACTTATCAACTTAAACTTTTTAGTTCCGGTAAACAATTACGAACCGATATTGACATGTTTTTTAATTGGGTTTTTATAGGGGTTGGAAACAGATCAAAGTGATAGTGAGATGATGGATGAGAGGTGCCATGGAGTTGGGGAAGAAGAGTGCTTGATCAGACGAACTCTAGCTGCCCACTTAGATTATGTGTATACTCAAAAGCATAAGCCATAG ATGGCTTCTAAATTCATCACCTTTCTCTGCCTAATCTTCCTCCTCCTCCTCTCCAACAGCCCGTCTGCCTACGCTGCCCGCCCCGTTCCCACCGTTTCATCCGATGCACCAGCTACCCAAATCCCAAATCAGGGGTTGGAAACAGATCAAAGTGATAGTGAGATGATGGATGAGAGGTGCCATGGAGTTGGGGAAGAAGAGTGCTTGATCAGACGAACTCTAGCTGCCCACTTAGATTATGTGTATACTCAAAAGCATAAGCCATAG ATGGCTTCTAAATTCATCACCTTTCTCTGCCTAATCTTCCTCCTCCTCCTCTCCAACAGCCCGTCTGCCTACGCTGCCCGCCCCGTTCCCACCGTTTCATCCGATGCACCAGCTACCCAAATCCCAAATCAGGGGTTGGAAACAGATCAAAGTGATAGTGAGATGATGGATGAGAGGTGCCATGGAGTTGGGGAAGAAGAGTGCTTGATCAGACGAACTCTAGCTGCCCACTTAGATTATGTGTATACTCAAAAGCATAAGCCATAG MASKFITFLCLIFLLLLSNSPSAYAARPVPTVSSDAPATQIPNQGLETDQSDSEMMDERCHGVGEEECLIRRTLAAHLDYVYTQKHKP
BLAST of Carg18533 vs. NCBI nr
Match: XP_023003386.1 (phytosulfokines-like [Cucurbita maxima]) HSP 1 Score: 168.3 bits (425), Expect = 1.2e-38 Identity = 87/89 (97.75%), Postives = 87/89 (97.75%), Query Frame = 0
BLAST of Carg18533 vs. NCBI nr
Match: XP_022963144.1 (phytosulfokines 3-like [Cucurbita moschata]) HSP 1 Score: 165.6 bits (418), Expect = 7.5e-38 Identity = 85/89 (95.51%), Postives = 86/89 (96.63%), Query Frame = 0
BLAST of Carg18533 vs. NCBI nr
Match: XP_023518620.1 (phytosulfokines-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 164.9 bits (416), Expect = 1.3e-37 Identity = 86/90 (95.56%), Postives = 86/90 (95.56%), Query Frame = 0
BLAST of Carg18533 vs. NCBI nr
Match: XP_022978001.1 (phytosulfokines-like [Cucurbita maxima]) HSP 1 Score: 107.8 bits (268), Expect = 1.9e-20 Identity = 58/91 (63.74%), Postives = 67/91 (73.63%), Query Frame = 0
BLAST of Carg18533 vs. NCBI nr
Match: KGN48631.1 (hypothetical protein Csa_6G495850 [Cucumis sativus]) HSP 1 Score: 104.4 bits (259), Expect = 2.0e-19 Identity = 61/91 (67.03%), Postives = 65/91 (71.43%), Query Frame = 0
BLAST of Carg18533 vs. TAIR10
Match: AT3G49780.1 (phytosulfokine 4 precursor) HSP 1 Score: 63.2 bits (152), Expect = 9.5e-11 Identity = 33/81 (40.74%), Postives = 46/81 (56.79%), Query Frame = 0
BLAST of Carg18533 vs. TAIR10
Match: AT5G65870.1 (phytosulfokine 5 precursor) HSP 1 Score: 60.1 bits (144), Expect = 8.0e-10 Identity = 41/86 (47.67%), Postives = 48/86 (55.81%), Query Frame = 0
BLAST of Carg18533 vs. TAIR10
Match: AT2G22860.1 (phytosulfokine 2 precursor) HSP 1 Score: 54.3 bits (129), Expect = 4.4e-08 Identity = 33/80 (41.25%), Postives = 43/80 (53.75%), Query Frame = 0
BLAST of Carg18533 vs. TAIR10
Match: AT4G37720.1 (phytosulfokine 6 precursor) HSP 1 Score: 47.8 bits (112), Expect = 4.1e-06 Identity = 28/73 (38.36%), Postives = 39/73 (53.42%), Query Frame = 0
BLAST of Carg18533 vs. TAIR10
Match: AT1G13590.1 (phytosulfokine 1 precursor) HSP 1 Score: 41.6 bits (96), Expect = 3.0e-04 Identity = 31/84 (36.90%), Postives = 45/84 (53.57%), Query Frame = 0
BLAST of Carg18533 vs. Swiss-Prot
Match: sp|Q9FS10|PSK_ASPOF (Phytosulfokines OS=Asparagus officinalis OX=4686 GN=PSK PE=1 SV=1) HSP 1 Score: 66.6 bits (161), Expect = 1.5e-10 Identity = 41/88 (46.59%), Postives = 49/88 (55.68%), Query Frame = 0
BLAST of Carg18533 vs. Swiss-Prot
Match: sp|Q9M2Y0|PSK3_ARATH (Phytosulfokines 3 OS=Arabidopsis thaliana OX=3702 GN=PSK3 PE=2 SV=2) HSP 1 Score: 63.2 bits (152), Expect = 1.7e-09 Identity = 33/81 (40.74%), Postives = 46/81 (56.79%), Query Frame = 0
BLAST of Carg18533 vs. Swiss-Prot
Match: sp|Q9FEB4|PSK5_ARATH (Phytosulfokines 5 OS=Arabidopsis thaliana OX=3702 GN=PSK5 PE=2 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 1.4e-08 Identity = 41/86 (47.67%), Postives = 48/86 (55.81%), Query Frame = 0
BLAST of Carg18533 vs. Swiss-Prot
Match: sp|O81003|PSK2_ARATH (Phytosulfokines 2 OS=Arabidopsis thaliana OX=3702 GN=PSK2 PE=2 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 8.0e-07 Identity = 33/80 (41.25%), Postives = 43/80 (53.75%), Query Frame = 0
BLAST of Carg18533 vs. Swiss-Prot
Match: sp|Q9SZG4|PSK4_ARATH (Putative phytosulfokines 4 OS=Arabidopsis thaliana OX=3702 GN=PSK4 PE=3 SV=1) HSP 1 Score: 47.8 bits (112), Expect = 7.4e-05 Identity = 28/73 (38.36%), Postives = 39/73 (53.42%), Query Frame = 0
BLAST of Carg18533 vs. TrEMBL
Match: tr|A0A0A0KLK0|A0A0A0KLK0_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G495850 PE=4 SV=1) HSP 1 Score: 104.4 bits (259), Expect = 1.4e-19 Identity = 61/91 (67.03%), Postives = 65/91 (71.43%), Query Frame = 0
BLAST of Carg18533 vs. TrEMBL
Match: tr|W9QZQ5|W9QZQ5_9ROSA (Phytosulfokines 3 OS=Morus notabilis OX=981085 GN=L484_003349 PE=4 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 1.6e-12 Identity = 44/89 (49.44%), Postives = 64/89 (71.91%), Query Frame = 0
BLAST of Carg18533 vs. TrEMBL
Match: tr|A0A2P5FS83|A0A2P5FS83_9ROSA (Phytosulfokine OS=Trema orientalis OX=63057 GN=TorRG33x02_032990 PE=4 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 8.0e-12 Identity = 45/78 (57.69%), Postives = 53/78 (67.95%), Query Frame = 0
BLAST of Carg18533 vs. TrEMBL
Match: tr|A0A2R6QSN3|A0A2R6QSN3_ACTCH (Phytosulfokine-beta like OS=Actinidia chinensis var. chinensis OX=1590841 GN=CEY00_Acc14749 PE=4 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 8.0e-12 Identity = 48/84 (57.14%), Postives = 58/84 (69.05%), Query Frame = 0
BLAST of Carg18533 vs. TrEMBL
Match: tr|B9HFY9|B9HFY9_POPTR (Uncharacterized protein OS=Populus trichocarpa OX=3694 GN=POPTR_007G006800v3 PE=4 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 8.0e-12 Identity = 48/88 (54.55%), Postives = 57/88 (64.77%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene: |