Cp4.1LG10g01890 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCCTTCTAAATTCTTCTCTTTCCGCTGCCTTATCTTTGTCATCCTCCTCCTCCTCCACCTCCTCTGCAACAGGCCACCACCAGCTCATGCTGCCCGCCCTGCTCCCGTCTTTGCATCACTGCCCACTCAGGTTTGTTACCGTAATCTATTCGCTTGAGTTTTATTGTTCAACGAGAATTCAGTAAGAACAAAGTGTTTTCTCTAACTAAATTGTATTCATTTGTACATCTTGTTGATATTGAGATGGTTCTTTAATTTGGTTTTGTAGGGGTTGGATGAGAACCTAACTGATAGCGAGAATATGGATGAGAAGTGCAGTGGAGTAAGCGAAGAAGAGTGTTTGATCAGACGAACTCTAGTTGCTCACTTAGATTACGTCTATACACAAAAGCATACCCCATAA ATGCCTTCTAAATTCTTCTCTTTCCGCTGCCTTATCTTTGTCATCCTCCTCCTCCTCCACCTCCTCTGCAACAGGCCACCACCAGCTCATGCTGCCCGCCCTGCTCCCGTCTTTGCATCACTGCCCACTCAGGGGTTGGATGAGAACCTAACTGATAGCGAGAATATGGATGAGAAGTGCAGTGGAGTAAGCGAAGAAGAGTGTTTGATCAGACGAACTCTAGTTGCTCACTTAGATTACGTCTATACACAAAAGCATACCCCATAA ATGCCTTCTAAATTCTTCTCTTTCCGCTGCCTTATCTTTGTCATCCTCCTCCTCCTCCACCTCCTCTGCAACAGGCCACCACCAGCTCATGCTGCCCGCCCTGCTCCCGTCTTTGCATCACTGCCCACTCAGGGGTTGGATGAGAACCTAACTGATAGCGAGAATATGGATGAGAAGTGCAGTGGAGTAAGCGAAGAAGAGTGTTTGATCAGACGAACTCTAGTTGCTCACTTAGATTACGTCTATACACAAAAGCATACCCCATAA MPSKFFSFRCLIFVILLLLHLLCNRPPPAHAARPAPVFASLPTQGLDENLTDSENMDEKCSGVSEEECLIRRTLVAHLDYVYTQKHTP
BLAST of Cp4.1LG10g01890 vs. Swiss-Prot
Match: PSK_ASPOF (Phytosulfokines OS=Asparagus officinalis GN=PSK PE=1 SV=1) HSP 1 Score: 57.8 bits (138), Expect = 7.1e-08 Identity = 35/76 (46.05%), Postives = 45/76 (59.21%), Query Frame = 1
BLAST of Cp4.1LG10g01890 vs. Swiss-Prot
Match: PSK3_ARATH (Phytosulfokines 3 OS=Arabidopsis thaliana GN=PSK3 PE=2 SV=2) HSP 1 Score: 56.6 bits (135), Expect = 1.6e-07 Identity = 30/75 (40.00%), Postives = 44/75 (58.67%), Query Frame = 1
BLAST of Cp4.1LG10g01890 vs. Swiss-Prot
Match: PSK5_ARATH (Phytosulfokines 5 OS=Arabidopsis thaliana GN=PSK5 PE=2 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 7.8e-07 Identity = 38/87 (43.68%), Postives = 47/87 (54.02%), Query Frame = 1
BLAST of Cp4.1LG10g01890 vs. Swiss-Prot
Match: PSK2_ARATH (Phytosulfokines 2 OS=Arabidopsis thaliana GN=PSK2 PE=2 SV=1) HSP 1 Score: 50.8 bits (120), Expect = 8.7e-06 Identity = 34/82 (41.46%), Postives = 45/82 (54.88%), Query Frame = 1
BLAST of Cp4.1LG10g01890 vs. TrEMBL
Match: A0A0A0KLK0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G495850 PE=4 SV=1) HSP 1 Score: 95.9 bits (237), Expect = 2.6e-17 Identity = 56/92 (60.87%), Postives = 62/92 (67.39%), Query Frame = 1
BLAST of Cp4.1LG10g01890 vs. TrEMBL
Match: B9SH34_RICCO (Phytosulfokines, putative OS=Ricinus communis GN=RCOM_0581720 PE=4 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 1.8e-10 Identity = 38/82 (46.34%), Postives = 52/82 (63.41%), Query Frame = 1
BLAST of Cp4.1LG10g01890 vs. TrEMBL
Match: A0A059B017_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_H02324 PE=4 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 5.8e-09 Identity = 35/61 (57.38%), Postives = 40/61 (65.57%), Query Frame = 1
BLAST of Cp4.1LG10g01890 vs. TrEMBL
Match: B9HFY9_POPTR (Phytosulfokines 3 family protein OS=Populus trichocarpa GN=POPTR_0007s14750g PE=4 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 5.8e-09 Identity = 36/78 (46.15%), Postives = 49/78 (62.82%), Query Frame = 1
BLAST of Cp4.1LG10g01890 vs. TrEMBL
Match: V4SFL8_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10026870mg PE=4 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 7.6e-09 Identity = 36/78 (46.15%), Postives = 46/78 (58.97%), Query Frame = 1
BLAST of Cp4.1LG10g01890 vs. TAIR10
Match: AT3G49780.1 (AT3G49780.1 phytosulfokine 4 precursor) HSP 1 Score: 56.6 bits (135), Expect = 8.9e-09 Identity = 30/75 (40.00%), Postives = 44/75 (58.67%), Query Frame = 1
BLAST of Cp4.1LG10g01890 vs. TAIR10
Match: AT5G65870.1 (AT5G65870.1 phytosulfokine 5 precursor) HSP 1 Score: 54.3 bits (129), Expect = 4.4e-08 Identity = 38/87 (43.68%), Postives = 47/87 (54.02%), Query Frame = 1
BLAST of Cp4.1LG10g01890 vs. TAIR10
Match: AT2G22860.1 (AT2G22860.1 phytosulfokine 2 precursor) HSP 1 Score: 50.8 bits (120), Expect = 4.9e-07 Identity = 34/82 (41.46%), Postives = 45/82 (54.88%), Query Frame = 1
BLAST of Cp4.1LG10g01890 vs. TAIR10
Match: AT4G37720.1 (AT4G37720.1 phytosulfokine 6 precursor) HSP 1 Score: 50.4 bits (119), Expect = 6.4e-07 Identity = 31/79 (39.24%), Postives = 43/79 (54.43%), Query Frame = 1
BLAST of Cp4.1LG10g01890 vs. NCBI nr
Match: gi|659079751|ref|XP_008440424.1| (PREDICTED: phytosulfokines 3 [Cucumis melo]) HSP 1 Score: 99.4 bits (246), Expect = 3.4e-18 Identity = 56/91 (61.54%), Postives = 65/91 (71.43%), Query Frame = 1
BLAST of Cp4.1LG10g01890 vs. NCBI nr
Match: gi|700193427|gb|KGN48631.1| (hypothetical protein Csa_6G495850 [Cucumis sativus]) HSP 1 Score: 95.9 bits (237), Expect = 3.7e-17 Identity = 56/92 (60.87%), Postives = 62/92 (67.39%), Query Frame = 1
BLAST of Cp4.1LG10g01890 vs. NCBI nr
Match: gi|255568659|ref|XP_002525303.1| (PREDICTED: phytosulfokines 3 [Ricinus communis]) HSP 1 Score: 73.2 bits (178), Expect = 2.6e-10 Identity = 38/82 (46.34%), Postives = 52/82 (63.41%), Query Frame = 1
BLAST of Cp4.1LG10g01890 vs. NCBI nr
Match: gi|694428431|ref|XP_009341786.1| (PREDICTED: phytosulfokines 3-like [Pyrus x bretschneideri]) HSP 1 Score: 71.2 bits (173), Expect = 9.9e-10 Identity = 37/84 (44.05%), Postives = 52/84 (61.90%), Query Frame = 1
BLAST of Cp4.1LG10g01890 vs. NCBI nr
Match: gi|658026941|ref|XP_008348895.1| (PREDICTED: phytosulfokines 3-like [Malus domestica]) HSP 1 Score: 70.1 bits (170), Expect = 2.2e-09 Identity = 36/84 (42.86%), Postives = 52/84 (61.90%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|