Cucsa.038020 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCGAATCTATATGGGGATTATAATCAGAAGATTGATTATGTTTTCAAAGTTGTGTTGATCGGAGATTCGGCTGTCGGCAAAACCCAGCTCCTTGCTCGATTTTCTCGGAATGAATTTAGCGTTGATTCCAAAGCTACTATTGGAGTCGAGTTTCAGACTAAAACTCTCGTCATTGATCAAAAAACAGTGAAAGCCCAGATATGGGATACTGCAGGACAAGAAAG ATGTCGAATCTATATGGGGATTATAATCAGAAGATTGATTATGTTTTCAAAGTTGTGTTGATCGGAGATTCGGCTGTCGGCAAAACCCAGCTCCTTGCTCGATTTTCTCGGAATGAATTTAGCGTTGATTCCAAAGCTACTATTGGAGTCGAGTTTCAGACTAAAACTCTCGTCATTGATCAAAAAACAGTGAAAGCCCAGATATGGGATACTGCAGGACAAGAAAG ATGTCGAATCTATATGGGGATTATAATCAGAAGATTGATTATGTTTTCAAAGTTGTGTTGATCGGAGATTCGGCTGTCGGCAAAACCCAGCTCCTTGCTCGATTTTCTCGGAATGAATTTAGCGTTGATTCCAAAGCTACTATTGGAGTCGAGTTTCAGACTAAAACTCTCGTCATTGATCAAAAAACAGTGAAAGCCCAGATATGGGATACTGCAGGACAAGAAAG MSNLYGDYNQKIDYVFKVVLIGDSAVGKTQLLARFSRNEFSVDSKATIGVEFQTKTLVIDQKTVKAQIWDTAGQEX
BLAST of Cucsa.038020 vs. Swiss-Prot
Match: RAA4D_ARATH (Ras-related protein RABA4d OS=Arabidopsis thaliana GN=RABA4D PE=1 SV=1) HSP 1 Score: 146.7 bits (369), Expect = 1.0e-34 Identity = 73/75 (97.33%), Postives = 74/75 (98.67%), Query Frame = 1
BLAST of Cucsa.038020 vs. Swiss-Prot
Match: RAA4C_ARATH (Ras-related protein RABA4c OS=Arabidopsis thaliana GN=RABA4C PE=2 SV=1) HSP 1 Score: 128.3 bits (321), Expect = 3.7e-29 Identity = 62/75 (82.67%), Postives = 70/75 (93.33%), Query Frame = 1
BLAST of Cucsa.038020 vs. Swiss-Prot
Match: RB11C_TOBAC (Ras-related protein Rab11C OS=Nicotiana tabacum GN=RAB11C PE=2 SV=1) HSP 1 Score: 128.3 bits (321), Expect = 3.7e-29 Identity = 63/75 (84.00%), Postives = 71/75 (94.67%), Query Frame = 1
BLAST of Cucsa.038020 vs. Swiss-Prot
Match: RB11A_LOTJA (Ras-related protein Rab11A OS=Lotus japonicus GN=RAB11A PE=2 SV=1) HSP 1 Score: 127.9 bits (320), Expect = 4.8e-29 Identity = 62/71 (87.32%), Postives = 68/71 (95.77%), Query Frame = 1
BLAST of Cucsa.038020 vs. Swiss-Prot
Match: RB11D_TOBAC (Ras-related protein Rab11D OS=Nicotiana tabacum GN=RAB11D PE=2 SV=1) HSP 1 Score: 125.2 bits (313), Expect = 3.1e-28 Identity = 61/75 (81.33%), Postives = 70/75 (93.33%), Query Frame = 1
BLAST of Cucsa.038020 vs. TrEMBL
Match: A0A0A0KW90_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G152280 PE=4 SV=1) HSP 1 Score: 149.8 bits (377), Expect = 1.3e-33 Identity = 75/75 (100.00%), Postives = 75/75 (100.00%), Query Frame = 1
BLAST of Cucsa.038020 vs. TrEMBL
Match: A0A078CFN9_BRANA (BnaA03g32140D protein OS=Brassica napus GN=BnaA03g32140D PE=4 SV=1) HSP 1 Score: 146.7 bits (369), Expect = 1.1e-32 Identity = 73/75 (97.33%), Postives = 74/75 (98.67%), Query Frame = 1
BLAST of Cucsa.038020 vs. TrEMBL
Match: D7KZQ3_ARALL (Predicted protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_672041 PE=4 SV=1) HSP 1 Score: 146.7 bits (369), Expect = 1.1e-32 Identity = 73/75 (97.33%), Postives = 74/75 (98.67%), Query Frame = 1
BLAST of Cucsa.038020 vs. TrEMBL
Match: A0A087H8X8_ARAAL (Uncharacterized protein OS=Arabis alpina GN=AALP_AA3G132100 PE=4 SV=1) HSP 1 Score: 146.7 bits (369), Expect = 1.1e-32 Identity = 73/75 (97.33%), Postives = 74/75 (98.67%), Query Frame = 1
BLAST of Cucsa.038020 vs. TrEMBL
Match: A0A0D3BAW7_BRAOL (Uncharacterized protein OS=Brassica oleracea var. oleracea PE=4 SV=1) HSP 1 Score: 146.7 bits (369), Expect = 1.1e-32 Identity = 73/75 (97.33%), Postives = 74/75 (98.67%), Query Frame = 1
BLAST of Cucsa.038020 vs. TAIR10
Match: AT3G12160.1 (AT3G12160.1 RAB GTPase homolog A4D) HSP 1 Score: 146.7 bits (369), Expect = 5.6e-36 Identity = 73/75 (97.33%), Postives = 74/75 (98.67%), Query Frame = 1
BLAST of Cucsa.038020 vs. TAIR10
Match: AT5G47960.1 (AT5G47960.1 RAB GTPase homolog A4C) HSP 1 Score: 128.3 bits (321), Expect = 2.1e-30 Identity = 62/75 (82.67%), Postives = 70/75 (93.33%), Query Frame = 1
BLAST of Cucsa.038020 vs. TAIR10
Match: AT5G65270.1 (AT5G65270.1 RAB GTPase homolog A4A) HSP 1 Score: 124.4 bits (311), Expect = 3.0e-29 Identity = 60/71 (84.51%), Postives = 69/71 (97.18%), Query Frame = 1
BLAST of Cucsa.038020 vs. TAIR10
Match: AT4G39990.1 (AT4G39990.1 RAB GTPase homolog A4B) HSP 1 Score: 118.6 bits (296), Expect = 1.6e-27 Identity = 57/71 (80.28%), Postives = 67/71 (94.37%), Query Frame = 1
BLAST of Cucsa.038020 vs. TAIR10
Match: AT1G01200.1 (AT1G01200.1 RAB GTPase homolog A3) HSP 1 Score: 106.3 bits (264), Expect = 8.4e-24 Identity = 51/66 (77.27%), Postives = 59/66 (89.39%), Query Frame = 1
BLAST of Cucsa.038020 vs. NCBI nr
Match: gi|449464898|ref|XP_004150166.1| (PREDICTED: ras-related protein RABA4d [Cucumis sativus]) HSP 1 Score: 149.8 bits (377), Expect = 1.9e-33 Identity = 75/75 (100.00%), Postives = 75/75 (100.00%), Query Frame = 1
BLAST of Cucsa.038020 vs. NCBI nr
Match: gi|659121765|ref|XP_008460801.1| (PREDICTED: ras-related protein RABA4d [Cucumis melo]) HSP 1 Score: 149.8 bits (377), Expect = 1.9e-33 Identity = 75/75 (100.00%), Postives = 75/75 (100.00%), Query Frame = 1
BLAST of Cucsa.038020 vs. NCBI nr
Match: gi|657964219|ref|XP_008373738.1| (PREDICTED: ras-related protein RABA4d [Malus domestica]) HSP 1 Score: 147.9 bits (372), Expect = 7.2e-33 Identity = 73/75 (97.33%), Postives = 75/75 (100.00%), Query Frame = 1
BLAST of Cucsa.038020 vs. NCBI nr
Match: gi|923671925|ref|XP_013650973.1| (PREDICTED: uncharacterized protein LOC106355602 [Brassica napus]) HSP 1 Score: 146.7 bits (369), Expect = 1.6e-32 Identity = 73/75 (97.33%), Postives = 74/75 (98.67%), Query Frame = 1
BLAST of Cucsa.038020 vs. NCBI nr
Match: gi|15230422|ref|NP_187823.1| (RAB GTPase-like protein A4D [Arabidopsis thaliana]) HSP 1 Score: 146.7 bits (369), Expect = 1.6e-32 Identity = 73/75 (97.33%), Postives = 74/75 (98.67%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|