CsaV3_6G005880 (gene) Cucumber (Chinese Long) v3
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTTCCTACTTCTCTGTTTTCGTAACTGTGATGGCGCTGATCATAGTGGTGGCCTCTGCAGAATCCAGGCCCTGCGACGACATCTATGTTGTCAAAGAAGGCGAGACGCTGCATACAATCAGTGCCAAGTGCGGCGATCCCTTCATCGTTGACAACAATCCCCACATTCAAGACTCCGATGATGTTTTCCCAGGACTCCTCATCCAAATTACCCCTACCCTCATCAACTCCAGAAAGTTGCTTCTGTAA ATGGCTTCCTACTTCTCTGTTTTCGTAACTGTGATGGCGCTGATCATAGTGGTGGCCTCTGCAGAATCCAGGCCCTGCGACGACATCTATGTTGTCAAAGAAGGCGAGACGCTGCATACAATCAGTGCCAAGTGCGGCGATCCCTTCATCGTTGACAACAATCCCCACATTCAAGACTCCGATGATGTTTTCCCAGGACTCCTCATCCAAATTACCCCTACCCTCATCAACTCCAGAAAGTTGCTTCTGTAA ATGGCTTCCTACTTCTCTGTTTTCGTAACTGTGATGGCGCTGATCATAGTGGTGGCCTCTGCAGAATCCAGGCCCTGCGACGACATCTATGTTGTCAAAGAAGGCGAGACGCTGCATACAATCAGTGCCAAGTGCGGCGATCCCTTCATCGTTGACAACAATCCCCACATTCAAGACTCCGATGATGTTTTCCCAGGACTCCTCATCCAAATTACCCCTACCCTCATCAACTCCAGAAAGTTGCTTCTGTAA MASYFSVFVTVMALIIVVASAESRPCDDIYVVKEGETLHTISAKCGDPFIVDNNPHIQDSDDVFPGLLIQITPTLINSRKLLL
BLAST of CsaV3_6G005880 vs. NCBI nr
Match: KGN46208.1 (hypothetical protein Csa_6G074605 [Cucumis sativus]) HSP 1 Score: 164.5 bits (415), Expect = 1.6e-37 Identity = 83/83 (100.00%), Postives = 83/83 (100.00%), Query Frame = 0
BLAST of CsaV3_6G005880 vs. NCBI nr
Match: XP_023006696.1 (uncharacterized protein LOC111499354 [Cucurbita maxima]) HSP 1 Score: 109.8 bits (273), Expect = 4.7e-21 Identity = 58/79 (73.42%), Postives = 70/79 (88.61%), Query Frame = 0
BLAST of CsaV3_6G005880 vs. NCBI nr
Match: XP_022959284.1 (uncharacterized protein LOC111460313 [Cucurbita moschata]) HSP 1 Score: 109.4 bits (272), Expect = 6.1e-21 Identity = 58/77 (75.32%), Postives = 69/77 (89.61%), Query Frame = 0
BLAST of CsaV3_6G005880 vs. NCBI nr
Match: XP_011042588.1 (PREDICTED: uncharacterized protein LOC105138239 [Populus euphratica]) HSP 1 Score: 102.1 bits (253), Expect = 9.7e-19 Identity = 47/60 (78.33%), Postives = 53/60 (88.33%), Query Frame = 0
BLAST of CsaV3_6G005880 vs. NCBI nr
Match: XP_002320100.1 (uncharacterized protein LOC7496935 [Populus trichocarpa] >PNT03585.1 hypothetical protein POPTR_014G077900v3 [Populus trichocarpa]) HSP 1 Score: 101.3 bits (251), Expect = 1.7e-18 Identity = 47/60 (78.33%), Postives = 53/60 (88.33%), Query Frame = 0
BLAST of CsaV3_6G005880 vs. TAIR10
Match: AT5G62150.1 (peptidoglycan-binding LysM domain-containing protein) HSP 1 Score: 89.4 bits (220), Expect = 1.2e-18 Identity = 39/59 (66.10%), Postives = 48/59 (81.36%), Query Frame = 0
BLAST of CsaV3_6G005880 vs. TAIR10
Match: AT3G52790.1 (peptidoglycan-binding LysM domain-containing protein) HSP 1 Score: 88.2 bits (217), Expect = 2.6e-18 Identity = 40/62 (64.52%), Postives = 50/62 (80.65%), Query Frame = 0
BLAST of CsaV3_6G005880 vs. TAIR10
Match: AT4G25433.1 (peptidoglycan-binding LysM domain-containing protein) HSP 1 Score: 85.1 bits (209), Expect = 2.2e-17 Identity = 35/48 (72.92%), Postives = 43/48 (89.58%), Query Frame = 0
BLAST of CsaV3_6G005880 vs. TrEMBL
Match: tr|A0A0A0K9P3|A0A0A0K9P3_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G074605 PE=4 SV=1) HSP 1 Score: 164.5 bits (415), Expect = 1.1e-37 Identity = 83/83 (100.00%), Postives = 83/83 (100.00%), Query Frame = 0
BLAST of CsaV3_6G005880 vs. TrEMBL
Match: tr|B9IC84|B9IC84_POPTR (Uncharacterized protein OS=Populus trichocarpa OX=3694 GN=POPTR_014G077900v3 PE=4 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 1.1e-18 Identity = 47/60 (78.33%), Postives = 53/60 (88.33%), Query Frame = 0
BLAST of CsaV3_6G005880 vs. TrEMBL
Match: tr|A0A151QVN2|A0A151QVN2_CAJCA (Uncharacterized protein OS=Cajanus cajan OX=3821 GN=KK1_044754 PE=4 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 2.4e-18 Identity = 47/71 (66.20%), Postives = 56/71 (78.87%), Query Frame = 0
BLAST of CsaV3_6G005880 vs. TrEMBL
Match: tr|A0A218WT23|A0A218WT23_PUNGR (Uncharacterized protein OS=Punica granatum OX=22663 GN=CDL15_Pgr021814 PE=4 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 3.2e-18 Identity = 46/59 (77.97%), Postives = 51/59 (86.44%), Query Frame = 0
BLAST of CsaV3_6G005880 vs. TrEMBL
Match: tr|A0A2N9JAZ8|A0A2N9JAZ8_FAGSY (Uncharacterized protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS61622 PE=4 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 3.2e-18 Identity = 45/59 (76.27%), Postives = 52/59 (88.14%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber chineselong genome (v3)
Date Performed: 2019-03-04
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene: |