Csa6G312030 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: five_prime_UTRCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.TATATACATATTTTTAAAATTTTTCTTTTTACCTTCCTCTCGTGAATTTCCAATGGCTGCCAAAGGAAACAGAGAGAGAGGTGGTGTGCTTAAATCACCGTGTAGGTCAGATACGTATACGGCGGCGCCAACGGCGTGGAATACGCATAGCCATTTACACGGTGGTTCGTCGTCGGTTTCTAACGGCCACGATGAACCGGAGGTTAAAAGGCAACGGCGGATTGCGAAGTACAAGGCTTACGCCGTTGAAAGCAAATTGAAATCGTCGCTTAGAAGTGGGATTCGGTGGGTAAAGATCAAATGCAATGAGCTTCTTCAACGTTGATATTTAATTGATTTAATTATTTCAATTTTCA ATGGCTGCCAAAGGAAACAGAGAGAGAGGTGGTGTGCTTAAATCACCGTGTAGGTCAGATACGTATACGGCGGCGCCAACGGCGTGGAATACGCATAGCCATTTACACGGTGGTTCGTCGTCGGTTTCTAACGGCCACGATGAACCGGAGGTTAAAAGGCAACGGCGGATTGCGAAGTACAAGGCTTACGCCGTTGAAAGCAAATTGAAATCGTCGCTTAGAAGTGGGATTCGGTGGGTAAAGATCAAATGCAATGAGCTTCTTCAACGTTGA ATGGCTGCCAAAGGAAACAGAGAGAGAGGTGGTGTGCTTAAATCACCGTGTAGGTCAGATACGTATACGGCGGCGCCAACGGCGTGGAATACGCATAGCCATTTACACGGTGGTTCGTCGTCGGTTTCTAACGGCCACGATGAACCGGAGGTTAAAAGGCAACGGCGGATTGCGAAGTACAAGGCTTACGCCGTTGAAAGCAAATTGAAATCGTCGCTTAGAAGTGGGATTCGGTGGGTAAAGATCAAATGCAATGAGCTTCTTCAACGTTGA MAAKGNRERGGVLKSPCRSDTYTAAPTAWNTHSHLHGGSSSVSNGHDEPEVKRQRRIAKYKAYAVESKLKSSLRSGIRWVKIKCNELLQR*
BLAST of Csa6G312030 vs. TrEMBL
Match: A0A0A0KCE9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G312030 PE=4 SV=1) HSP 1 Score: 187.2 bits (474), Expect = 8.9e-45 Identity = 90/90 (100.00%), Postives = 90/90 (100.00%), Query Frame = 1
BLAST of Csa6G312030 vs. TrEMBL
Match: A0A0A9PAJ0_ARUDO (Uncharacterized protein OS=Arundo donax PE=4 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 4.2e-10 Identity = 40/84 (47.62%), Postives = 54/84 (64.29%), Query Frame = 1
BLAST of Csa6G312030 vs. TrEMBL
Match: M0TP99_MUSAM (Uncharacterized protein OS=Musa acuminata subsp. malaccensis PE=4 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 5.5e-10 Identity = 40/82 (48.78%), Postives = 51/82 (62.20%), Query Frame = 1
BLAST of Csa6G312030 vs. TrEMBL
Match: K4AMM2_SETIT (Uncharacterized protein OS=Setaria italica GN=SETIT_040166mg PE=4 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 1.2e-09 Identity = 40/89 (44.94%), Postives = 53/89 (59.55%), Query Frame = 1
BLAST of Csa6G312030 vs. TrEMBL
Match: C5WMK1_SORBI (Putative uncharacterized protein Sb01g037750 OS=Sorghum bicolor GN=Sb01g037750 PE=4 SV=1) HSP 1 Score: 69.3 bits (168), Expect = 2.7e-09 Identity = 39/84 (46.43%), Postives = 52/84 (61.90%), Query Frame = 1
BLAST of Csa6G312030 vs. TAIR10
Match: AT2G19460.1 (AT2G19460.1 Protein of unknown function (DUF3511)) HSP 1 Score: 60.1 bits (144), Expect = 8.3e-10 Identity = 30/72 (41.67%), Postives = 42/72 (58.33%), Query Frame = 1
BLAST of Csa6G312030 vs. TAIR10
Match: AT2G47480.1 (AT2G47480.1 Protein of unknown function (DUF3511)) HSP 1 Score: 59.7 bits (143), Expect = 1.1e-09 Identity = 26/55 (47.27%), Postives = 38/55 (69.09%), Query Frame = 1
BLAST of Csa6G312030 vs. TAIR10
Match: AT3G05725.1 (AT3G05725.1 Protein of unknown function (DUF3511)) HSP 1 Score: 57.0 bits (136), Expect = 7.0e-09 Identity = 28/83 (33.73%), Postives = 47/83 (56.63%), Query Frame = 1
BLAST of Csa6G312030 vs. TAIR10
Match: AT5G11970.1 (AT5G11970.1 Protein of unknown function (DUF3511)) HSP 1 Score: 47.4 bits (111), Expect = 5.6e-06 Identity = 20/48 (41.67%), Postives = 31/48 (64.58%), Query Frame = 1
BLAST of Csa6G312030 vs. TAIR10
Match: AT4G09890.1 (AT4G09890.1 Protein of unknown function (DUF3511)) HSP 1 Score: 47.0 bits (110), Expect = 7.3e-06 Identity = 25/71 (35.21%), Postives = 42/71 (59.15%), Query Frame = 1
BLAST of Csa6G312030 vs. NCBI nr
Match: gi|700192196|gb|KGN47400.1| (hypothetical protein Csa_6G312030 [Cucumis sativus]) HSP 1 Score: 187.2 bits (474), Expect = 1.3e-44 Identity = 90/90 (100.00%), Postives = 90/90 (100.00%), Query Frame = 1
BLAST of Csa6G312030 vs. NCBI nr
Match: gi|695047519|ref|XP_009411641.1| (PREDICTED: uncharacterized protein LOC103993342 [Musa acuminata subsp. malaccensis]) HSP 1 Score: 71.6 bits (174), Expect = 7.8e-10 Identity = 40/82 (48.78%), Postives = 51/82 (62.20%), Query Frame = 1
BLAST of Csa6G312030 vs. NCBI nr
Match: gi|944226828|gb|KQK91232.1| (hypothetical protein SETIT_040166mg, partial [Setaria italica]) HSP 1 Score: 70.5 bits (171), Expect = 1.7e-09 Identity = 40/89 (44.94%), Postives = 53/89 (59.55%), Query Frame = 1
BLAST of Csa6G312030 vs. NCBI nr
Match: gi|514819917|ref|XP_004984650.1| (PREDICTED: uncharacterized protein LOC101764593 [Setaria italica]) HSP 1 Score: 70.5 bits (171), Expect = 1.7e-09 Identity = 40/89 (44.94%), Postives = 53/89 (59.55%), Query Frame = 1
BLAST of Csa6G312030 vs. NCBI nr
Match: gi|296083284|emb|CBI22920.3| (unnamed protein product [Vitis vinifera]) HSP 1 Score: 69.3 bits (168), Expect = 3.9e-09 Identity = 37/83 (44.58%), Postives = 52/83 (62.65%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|