Cp4.1LG12g03070 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTGCCAACGGAAACAGAGGCAGAGGAAGAGAGCTAAAAAAACCTTGTAGATCAGATACGTACGTAAGCAGTGAGAACCACCAGCTACCGGCGGCTTCAACGGCGGCGTGCCACGATGAACCGGAGGCTAAAAGGCAACGGCGGGTTGCGAAGTACAAGGCCTACGCCGTCGAAAGCAAATTCAAAGCATCGCTTAGGAATGGGATTCGGTGGGTTAAGATCAAGTGTAGTGAGCTTCTTAACCGTTGA ATGGCTGCCAACGGAAACAGAGGCAGAGGAAGAGAGCTAAAAAAACCTTGTAGATCAGATACGTACGTAAGCAGTGAGAACCACCAGCTACCGGCGGCTTCAACGGCGGCGTGCCACGATGAACCGGAGGCTAAAAGGCAACGGCGGGTTGCGAAGTACAAGGCCTACGCCGTCGAAAGCAAATTCAAAGCATCGCTTAGGAATGGGATTCGGTGGGTTAAGATCAAGTGTAGTGAGCTTCTTAACCGTTGA ATGGCTGCCAACGGAAACAGAGGCAGAGGAAGAGAGCTAAAAAAACCTTGTAGATCAGATACGTACGTAAGCAGTGAGAACCACCAGCTACCGGCGGCTTCAACGGCGGCGTGCCACGATGAACCGGAGGCTAAAAGGCAACGGCGGGTTGCGAAGTACAAGGCCTACGCCGTCGAAAGCAAATTCAAAGCATCGCTTAGGAATGGGATTCGGTGGGTTAAGATCAAGTGTAGTGAGCTTCTTAACCGTTGA MAANGNRGRGRELKKPCRSDTYVSSENHQLPAASTAACHDEPEAKRQRRVAKYKAYAVESKFKASLRNGIRWVKIKCSELLNR
BLAST of Cp4.1LG12g03070 vs. TrEMBL
Match: A0A0A0KCE9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G312030 PE=4 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 1.2e-19 Identity = 57/90 (63.33%), Postives = 66/90 (73.33%), Query Frame = 1
BLAST of Cp4.1LG12g03070 vs. TrEMBL
Match: M0RPK9_MUSAM (Uncharacterized protein OS=Musa acuminata subsp. malaccensis PE=4 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 3.8e-10 Identity = 34/51 (66.67%), Postives = 41/51 (80.39%), Query Frame = 1
BLAST of Cp4.1LG12g03070 vs. TrEMBL
Match: M0TP99_MUSAM (Uncharacterized protein OS=Musa acuminata subsp. malaccensis PE=4 SV=1) HSP 1 Score: 70.9 bits (172), Expect = 8.5e-10 Identity = 33/49 (67.35%), Postives = 41/49 (83.67%), Query Frame = 1
BLAST of Cp4.1LG12g03070 vs. TrEMBL
Match: C5WMK1_SORBI (Putative uncharacterized protein Sb01g037750 OS=Sorghum bicolor GN=Sb01g037750 PE=4 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 1.2e-08 Identity = 39/81 (48.15%), Postives = 50/81 (61.73%), Query Frame = 1
BLAST of Cp4.1LG12g03070 vs. TrEMBL
Match: A0A0D9VT39_9ORYZ (Uncharacterized protein OS=Leersia perrieri PE=4 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 1.2e-08 Identity = 31/48 (64.58%), Postives = 38/48 (79.17%), Query Frame = 1
BLAST of Cp4.1LG12g03070 vs. TAIR10
Match: AT2G47480.1 (AT2G47480.1 Protein of unknown function (DUF3511)) HSP 1 Score: 54.7 bits (130), Expect = 3.2e-08 Identity = 22/43 (51.16%), Postives = 35/43 (81.40%), Query Frame = 1
BLAST of Cp4.1LG12g03070 vs. TAIR10
Match: AT3G05725.1 (AT3G05725.1 Protein of unknown function (DUF3511)) HSP 1 Score: 53.9 bits (128), Expect = 5.4e-08 Identity = 22/43 (51.16%), Postives = 34/43 (79.07%), Query Frame = 1
BLAST of Cp4.1LG12g03070 vs. TAIR10
Match: AT2G19460.1 (AT2G19460.1 Protein of unknown function (DUF3511)) HSP 1 Score: 49.7 bits (117), Expect = 1.0e-06 Identity = 20/42 (47.62%), Postives = 30/42 (71.43%), Query Frame = 1
BLAST of Cp4.1LG12g03070 vs. NCBI nr
Match: gi|700192196|gb|KGN47400.1| (hypothetical protein Csa_6G312030 [Cucumis sativus]) HSP 1 Score: 103.6 bits (257), Expect = 1.7e-19 Identity = 57/90 (63.33%), Postives = 66/90 (73.33%), Query Frame = 1
BLAST of Cp4.1LG12g03070 vs. NCBI nr
Match: gi|695070922|ref|XP_009382510.1| (PREDICTED: uncharacterized protein LOC103970456 [Musa acuminata subsp. malaccensis]) HSP 1 Score: 72.0 bits (175), Expect = 5.5e-10 Identity = 34/51 (66.67%), Postives = 41/51 (80.39%), Query Frame = 1
BLAST of Cp4.1LG12g03070 vs. NCBI nr
Match: gi|695047519|ref|XP_009411641.1| (PREDICTED: uncharacterized protein LOC103993342 [Musa acuminata subsp. malaccensis]) HSP 1 Score: 70.9 bits (172), Expect = 1.2e-09 Identity = 33/49 (67.35%), Postives = 41/49 (83.67%), Query Frame = 1
BLAST of Cp4.1LG12g03070 vs. NCBI nr
Match: gi|944226828|gb|KQK91232.1| (hypothetical protein SETIT_040166mg, partial [Setaria italica]) HSP 1 Score: 67.0 bits (162), Expect = 1.8e-08 Identity = 31/48 (64.58%), Postives = 38/48 (79.17%), Query Frame = 1
BLAST of Cp4.1LG12g03070 vs. NCBI nr
Match: gi|514819917|ref|XP_004984650.1| (PREDICTED: uncharacterized protein LOC101764593 [Setaria italica]) HSP 1 Score: 67.0 bits (162), Expect = 1.8e-08 Identity = 31/48 (64.58%), Postives = 38/48 (79.17%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene: |