Csa5G175840 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: five_prime_UTRCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.CTTCCTTCCATTCAACTCTCTTCTCTCTCTCTTTGCTTGTGATCAGAGATGGGTTTGGTGGTGGTGATCTCTCTGCCTTTGATTTTCTTCTGCTTGTTGCTTGGTTTCGGATGTTACTTTCTAGGCCGAGCAAAAGGGAGACAAGACATACGGACTAATGCACAGATATTCGGTGTGCCCACGCCGCCACCTGGTAGTGGTGCAGCTCATTCGCCATCATCACTGCAGCCGGTTTTCAAACCTGAAAATACCACCAATGTTTGATTAGTAATCAGATCTAAGTTCAATTCTTCACTGTACTGCTGTTTGTGACTTTGTGTATGTAAATTCTGTACTATGAGTTTAAACTTCAATACTCTATGGGTGAATCATTTTTCCAGTTA ATGGGTTTGGTGGTGGTGATCTCTCTGCCTTTGATTTTCTTCTGCTTGTTGCTTGGTTTCGGATGTTACTTTCTAGGCCGAGCAAAAGGGAGACAAGACATACGGACTAATGCACAGATATTCGGTGTGCCCACGCCGCCACCTGGTAGTGGTGCAGCTCATTCGCCATCATCACTGCAGCCGGTTTTCAAACCTGAAAATACCACCAATGTTTGA ATGGGTTTGGTGGTGGTGATCTCTCTGCCTTTGATTTTCTTCTGCTTGTTGCTTGGTTTCGGATGTTACTTTCTAGGCCGAGCAAAAGGGAGACAAGACATACGGACTAATGCACAGATATTCGGTGTGCCCACGCCGCCACCTGGTAGTGGTGCAGCTCATTCGCCATCATCACTGCAGCCGGTTTTCAAACCTGAAAATACCACCAATGTTTGA MGLVVVISLPLIFFCLLLGFGCYFLGRAKGRQDIRTNAQIFGVPTPPPGSGAAHSPSSLQPVFKPENTTNV*
BLAST of Csa5G175840 vs. TrEMBL
Match: A0A0A0KRY6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G175840 PE=4 SV=1) HSP 1 Score: 149.1 bits (375), Expect = 2.1e-33 Identity = 71/71 (100.00%), Postives = 71/71 (100.00%), Query Frame = 1
BLAST of Csa5G175840 vs. TrEMBL
Match: R0I4P3_9BRAS (Uncharacterized protein OS=Capsella rubella GN=CARUB_v10010814mg PE=4 SV=1) HSP 1 Score: 106.3 bits (264), Expect = 1.6e-20 Identity = 50/71 (70.42%), Postives = 60/71 (84.51%), Query Frame = 1
BLAST of Csa5G175840 vs. TrEMBL
Match: Q8LG39_ARATH (At1g31335 OS=Arabidopsis thaliana GN=At1g31335 PE=2 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 2.1e-20 Identity = 50/71 (70.42%), Postives = 60/71 (84.51%), Query Frame = 1
BLAST of Csa5G175840 vs. TrEMBL
Match: D7KL22_ARALL (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_473639 PE=4 SV=1) HSP 1 Score: 104.0 bits (258), Expect = 7.8e-20 Identity = 49/71 (69.01%), Postives = 59/71 (83.10%), Query Frame = 1
BLAST of Csa5G175840 vs. TrEMBL
Match: A9PCK5_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0003s14790g PE=2 SV=1) HSP 1 Score: 101.7 bits (252), Expect = 3.9e-19 Identity = 49/71 (69.01%), Postives = 55/71 (77.46%), Query Frame = 1
BLAST of Csa5G175840 vs. TAIR10
Match: AT1G31335.1 (AT1G31335.1 unknown protein) HSP 1 Score: 105.9 bits (263), Expect = 1.0e-23 Identity = 50/71 (70.42%), Postives = 58/71 (81.69%), Query Frame = 1
BLAST of Csa5G175840 vs. NCBI nr
Match: gi|449451725|ref|XP_004143612.1| (PREDICTED: uncharacterized protein LOC101203814 [Cucumis sativus]) HSP 1 Score: 149.1 bits (375), Expect = 3.1e-33 Identity = 71/71 (100.00%), Postives = 71/71 (100.00%), Query Frame = 1
BLAST of Csa5G175840 vs. NCBI nr
Match: gi|659090148|ref|XP_008445862.1| (PREDICTED: uncharacterized protein LOC103488752 [Cucumis melo]) HSP 1 Score: 146.7 bits (369), Expect = 1.5e-32 Identity = 70/71 (98.59%), Postives = 70/71 (98.59%), Query Frame = 1
BLAST of Csa5G175840 vs. NCBI nr
Match: gi|565493444|ref|XP_006304361.1| (hypothetical protein CARUB_v10010814mg [Capsella rubella]) HSP 1 Score: 106.3 bits (264), Expect = 2.3e-20 Identity = 50/71 (70.42%), Postives = 60/71 (84.51%), Query Frame = 1
BLAST of Csa5G175840 vs. NCBI nr
Match: gi|18397903|ref|NP_564378.1| (uncharacterized protein [Arabidopsis thaliana]) HSP 1 Score: 105.9 bits (263), Expect = 3.0e-20 Identity = 50/71 (70.42%), Postives = 60/71 (84.51%), Query Frame = 1
BLAST of Csa5G175840 vs. NCBI nr
Match: gi|297846542|ref|XP_002891152.1| (hypothetical protein ARALYDRAFT_473639 [Arabidopsis lyrata subsp. lyrata]) HSP 1 Score: 104.0 bits (258), Expect = 1.1e-19 Identity = 49/71 (69.01%), Postives = 59/71 (83.10%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|