Csa3G893400 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: five_prime_UTRCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.TGTTTTGTATGTGTTGTTTCTTTTGCTGTTGTCTTCACTGGGAGAAGCTCCGATCCTTTCTTGGCTGCCCCGATCATCTCCACCACCACCATCCTCCCATTCCCCAGCCCCAATCCCCCGCCCCCGATAAAGTTTCGCCTATTCACTCGGTGCGTCCTTTTCTTCATTTCTTCATTATTTTAAATACCATAATCCAATTTGTTTTCTTATATATACGTTTAACTAATCTTTCCTTCTTCGTCTATTATTCTCTTAACAACCAGAAGATATGGAAGGAGAATCGGCCGCAAAGCGTATCCGTGTTGATGCCCGGCGACGAGGTTCCGAGGTTTATAGCAATGGCGTGTCCGGCGTTGGTGGAAATTGTAGTACAAAAACCTTCGCAAAGTATTTCAGATAATCCTTAATTATTCTCTGTAGCCTTCCCTCTTTAATTAATTAAATACTG ATGTGTTGTTTCTTTTGCTGTTGTCTTCACTGGGAGAAGCTCCGATCCTTTCTTGGCTGCCCCGATCATCTCCACCACCACCATCCTCCCATTCCCCAGCCCCAATCCCCCGCCCCCGATAAAGTTTCGCCTATTCACTCGATATGGAAGGAGAATCGGCCGCAAAGCGTATCCGTGTTGATGCCCGGCGACGAGGTTCCGAGGTTTATAGCAATGGCGTGTCCGGCGTTGGTGGAAATTGTAGTACAAAAACCTTCGCAAAGTATTTCAGATAATCCTTAA ATGTGTTGTTTCTTTTGCTGTTGTCTTCACTGGGAGAAGCTCCGATCCTTTCTTGGCTGCCCCGATCATCTCCACCACCACCATCCTCCCATTCCCCAGCCCCAATCCCCCGCCCCCGATAAAGTTTCGCCTATTCACTCGATATGGAAGGAGAATCGGCCGCAAAGCGTATCCGTGTTGATGCCCGGCGACGAGGTTCCGAGGTTTATAGCAATGGCGTGTCCGGCGTTGGTGGAAATTGTAGTACAAAAACCTTCGCAAAGTATTTCAGATAATCCTTAA MCCFFCCCLHWEKLRSFLGCPDHLHHHHPPIPQPQSPAPDKVSPIHSIWKENRPQSVSVLMPGDEVPRFIAMACPALVEIVVQKPSQSISDNP*
BLAST of Csa3G893400 vs. Swiss-Prot
Match: Y5566_ARATH (Uncharacterized protein At5g65660 OS=Arabidopsis thaliana GN=At5g65660 PE=2 SV=1) HSP 1 Score: 50.8 bits (120), Expect = 9.2e-06 Identity = 35/95 (36.84%), Postives = 42/95 (44.21%), Query Frame = 1
BLAST of Csa3G893400 vs. TrEMBL
Match: A0A0A0LE40_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G893400 PE=4 SV=1) HSP 1 Score: 210.3 bits (534), Expect = 1.0e-51 Identity = 93/93 (100.00%), Postives = 93/93 (100.00%), Query Frame = 1
BLAST of Csa3G893400 vs. TrEMBL
Match: V7AVS6_PHAVU (Uncharacterized protein OS=Phaseolus vulgaris GN=PHAVU_009G145900g PE=4 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 2.2e-14 Identity = 41/77 (53.25%), Postives = 48/77 (62.34%), Query Frame = 1
BLAST of Csa3G893400 vs. TrEMBL
Match: A0A151RUP1_CAJCA (Uncharacterized protein At5g65660 family OS=Cajanus cajan GN=KK1_032191 PE=4 SV=1) HSP 1 Score: 80.1 bits (196), Expect = 1.6e-12 Identity = 42/94 (44.68%), Postives = 52/94 (55.32%), Query Frame = 1
BLAST of Csa3G893400 vs. TrEMBL
Match: U5GPZ9_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0002s10890g PE=4 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 2.7e-12 Identity = 42/91 (46.15%), Postives = 52/91 (57.14%), Query Frame = 1
BLAST of Csa3G893400 vs. TrEMBL
Match: A0A0B2PIN6_GLYSO (Uncharacterized protein OS=Glycine soja GN=glysoja_021857 PE=4 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 3.9e-11 Identity = 39/89 (43.82%), Postives = 50/89 (56.18%), Query Frame = 1
BLAST of Csa3G893400 vs. TAIR10
Match: AT5G65660.1 (AT5G65660.1 hydroxyproline-rich glycoprotein family protein) HSP 1 Score: 50.8 bits (120), Expect = 5.2e-07 Identity = 35/95 (36.84%), Postives = 42/95 (44.21%), Query Frame = 1
BLAST of Csa3G893400 vs. NCBI nr
Match: gi|778687646|ref|XP_011652602.1| (PREDICTED: uncharacterized protein At5g65660-like isoform X2 [Cucumis sativus]) HSP 1 Score: 210.3 bits (534), Expect = 1.5e-51 Identity = 93/93 (100.00%), Postives = 93/93 (100.00%), Query Frame = 1
BLAST of Csa3G893400 vs. NCBI nr
Match: gi|700205157|gb|KGN60290.1| (hypothetical protein Csa_3G893400 [Cucumis sativus]) HSP 1 Score: 210.3 bits (534), Expect = 1.5e-51 Identity = 93/93 (100.00%), Postives = 93/93 (100.00%), Query Frame = 1
BLAST of Csa3G893400 vs. NCBI nr
Match: gi|449436926|ref|XP_004136243.1| (PREDICTED: uncharacterized protein At5g65660-like isoform X1 [Cucumis sativus]) HSP 1 Score: 205.7 bits (522), Expect = 3.6e-50 Identity = 93/94 (98.94%), Postives = 93/94 (98.94%), Query Frame = 1
BLAST of Csa3G893400 vs. NCBI nr
Match: gi|659132273|ref|XP_008466113.1| (PREDICTED: uncharacterized protein At5g65660-like [Cucumis melo]) HSP 1 Score: 184.5 bits (467), Expect = 8.6e-44 Identity = 86/103 (83.50%), Postives = 89/103 (86.41%), Query Frame = 1
BLAST of Csa3G893400 vs. NCBI nr
Match: gi|593328486|ref|XP_007137670.1| (hypothetical protein PHAVU_009G145900g [Phaseolus vulgaris]) HSP 1 Score: 86.3 bits (212), Expect = 3.2e-14 Identity = 41/77 (53.25%), Postives = 48/77 (62.34%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |