Csa3G146700 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: five_prime_UTRCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.AACACCAAGTTTGTTTCAGAAAACTAATTTCTCAAGACTCCCTACCGCTGTGAATCTGTGATGGGGCCATGCTTGAAATCAGAACCTTATCTCTTCATCAACGCCCTCGAATGGTCACAACCTCACAAATTACCTCATTTTCAATTCATCCCTAAGCAGAGAAAAGAAAACAATGGCAACTCTTCATTTTGTTCCTTCCGCTTTCTCCCTACCAAAACAAAAGCAACCCATCAAGCTTTCCTCAGTCAGACCCACTACTCAGATAAGCTGTTCACGACGGCGCTTGGTGGTCCGGTCGTACAAAGTAGTGATTGAGCACGAGGGGCAGACTACCGAGCTTGAGGTCGATCCCGATGAGAGCATATTGAGCAGTGCCTTGGACAATGGCTTAGAAATTCCTCACGATTGCAAGCTTGGAGTTTGCATGACTTGCCCTGCTCGCCTTGTCAGTGGCACCGTCGACCAAAGCGAAGGTATGTTGAGCGATGACGTTGTGGCACAAGGCTATTCGCTTCTATGTGTGGCTTATCCTCGCTCAGATTGCCACATTAAAACCATCCCTGAGGAGGAATTGTTGGCACTTCAATTAGCCACGGCTAATGACTAAAATCTGAGTACTTCGTTGGATGATTTTGTAGATTTAATTCTGGTTTAGTTTATAACTATATTGAAATCGATCTATCTGGGATGTTGTCTCTTTTGGCTGTTGTTTGGTCATTTGGGTATAATGATAAATCTTTTCATTTGATTCCAGTCAGTAGCAGATGGAAATGGATGTATATTGTTAAAGAATCCCAACCTATTTCTCCATCTAGAGCTTCTAATTTTGGAAAATA ATGGCAACTCTTCATTTTGTTCCTTCCGCTTTCTCCCTACCAAAACAAAAGCAACCCATCAAGCTTTCCTCAGTCAGACCCACTACTCAGATAAGCTGTTCACGACGGCGCTTGGTGGTCCGGTCGTACAAAGTAGTGATTGAGCACGAGGGGCAGACTACCGAGCTTGAGGTCGATCCCGATGAGAGCATATTGAGCAGTGCCTTGGACAATGGCTTAGAAATTCCTCACGATTGCAAGCTTGGAGTTTGCATGACTTGCCCTGCTCGCCTTGTCAGTGGCACCGTCGACCAAAGCGAAGGTATGTTGAGCGATGACGTTGTGGCACAAGGCTATTCGCTTCTATGTGTGGCTTATCCTCGCTCAGATTGCCACATTAAAACCATCCCTGAGGAGGAATTGTTGGCACTTCAATTAGCCACGGCTAATGACTAA ATGGCAACTCTTCATTTTGTTCCTTCCGCTTTCTCCCTACCAAAACAAAAGCAACCCATCAAGCTTTCCTCAGTCAGACCCACTACTCAGATAAGCTGTTCACGACGGCGCTTGGTGGTCCGGTCGTACAAAGTAGTGATTGAGCACGAGGGGCAGACTACCGAGCTTGAGGTCGATCCCGATGAGAGCATATTGAGCAGTGCCTTGGACAATGGCTTAGAAATTCCTCACGATTGCAAGCTTGGAGTTTGCATGACTTGCCCTGCTCGCCTTGTCAGTGGCACCGTCGACCAAAGCGAAGGTATGTTGAGCGATGACGTTGTGGCACAAGGCTATTCGCTTCTATGTGTGGCTTATCCTCGCTCAGATTGCCACATTAAAACCATCCCTGAGGAGGAATTGTTGGCACTTCAATTAGCCACGGCTAATGACTAA MATLHFVPSAFSLPKQKQPIKLSSVRPTTQISCSRRRLVVRSYKVVIEHEGQTTELEVDPDESILSSALDNGLEIPHDCKLGVCMTCPARLVSGTVDQSEGMLSDDVVAQGYSLLCVAYPRSDCHIKTIPEEELLALQLATAND*
BLAST of Csa3G146700 vs. Swiss-Prot
Match: FER2_SYNP6 (Ferredoxin-2 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=petF2 PE=3 SV=2) HSP 1 Score: 95.9 bits (237), Expect = 3.9e-19 Identity = 47/98 (47.96%), Postives = 64/98 (65.31%), Query Frame = 1
BLAST of Csa3G146700 vs. Swiss-Prot
Match: FER1_DESMC (Ferredoxin-1 OS=Desmonostoc muscorum PE=1 SV=2) HSP 1 Score: 94.7 bits (234), Expect = 8.6e-19 Identity = 47/94 (50.00%), Postives = 61/94 (64.89%), Query Frame = 1
BLAST of Csa3G146700 vs. Swiss-Prot
Match: FER_MASLA (Ferredoxin OS=Mastigocladus laminosus GN=petF PE=1 SV=2) HSP 1 Score: 94.0 bits (232), Expect = 1.5e-18 Identity = 47/96 (48.96%), Postives = 61/96 (63.54%), Query Frame = 1
BLAST of Csa3G146700 vs. Swiss-Prot
Match: FER1_LEPBY (Ferredoxin-1 OS=Leptolyngbya boryana GN=petF1 PE=1 SV=1) HSP 1 Score: 92.8 bits (229), Expect = 3.3e-18 Identity = 46/96 (47.92%), Postives = 60/96 (62.50%), Query Frame = 1
BLAST of Csa3G146700 vs. Swiss-Prot
Match: FER_CHLFR (Ferredoxin OS=Chlorogloeopsis fritschii PE=1 SV=2) HSP 1 Score: 92.8 bits (229), Expect = 3.3e-18 Identity = 47/96 (48.96%), Postives = 60/96 (62.50%), Query Frame = 1
BLAST of Csa3G146700 vs. TrEMBL
Match: A0A0A0L4U6_CUCSA (Ferredoxin-1 OS=Cucumis sativus GN=Csa_3G146700 PE=4 SV=1) HSP 1 Score: 288.9 bits (738), Expect = 3.5e-75 Identity = 144/144 (100.00%), Postives = 144/144 (100.00%), Query Frame = 1
BLAST of Csa3G146700 vs. TrEMBL
Match: W9R8L4_9ROSA (Ferredoxin-3 OS=Morus notabilis GN=L484_004463 PE=4 SV=1) HSP 1 Score: 211.8 bits (538), Expect = 5.4e-52 Identity = 106/146 (72.60%), Postives = 127/146 (86.99%), Query Frame = 1
BLAST of Csa3G146700 vs. TrEMBL
Match: F6HDQ5_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_05s0020g03490 PE=4 SV=1) HSP 1 Score: 208.4 bits (529), Expect = 5.9e-51 Identity = 106/147 (72.11%), Postives = 123/147 (83.67%), Query Frame = 1
BLAST of Csa3G146700 vs. TrEMBL
Match: B9RTR5_RICCO (Ferredoxin-1, putative OS=Ricinus communis GN=RCOM_0912010 PE=4 SV=1) HSP 1 Score: 207.2 bits (526), Expect = 1.3e-50 Identity = 103/150 (68.67%), Postives = 125/150 (83.33%), Query Frame = 1
BLAST of Csa3G146700 vs. TrEMBL
Match: V4RGX0_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10006141mg PE=4 SV=1) HSP 1 Score: 205.3 bits (521), Expect = 5.0e-50 Identity = 108/152 (71.05%), Postives = 124/152 (81.58%), Query Frame = 1
BLAST of Csa3G146700 vs. TAIR10
Match: AT4G14890.1 (AT4G14890.1 2Fe-2S ferredoxin-like superfamily protein) HSP 1 Score: 183.0 bits (463), Expect = 1.4e-46 Identity = 86/139 (61.87%), Postives = 111/139 (79.86%), Query Frame = 1
BLAST of Csa3G146700 vs. TAIR10
Match: AT2G27510.1 (AT2G27510.1 ferredoxin 3) HSP 1 Score: 89.0 bits (219), Expect = 2.7e-18 Identity = 45/94 (47.87%), Postives = 60/94 (63.83%), Query Frame = 1
BLAST of Csa3G146700 vs. TAIR10
Match: AT1G10960.1 (AT1G10960.1 ferredoxin 1) HSP 1 Score: 78.6 bits (192), Expect = 3.6e-15 Identity = 52/140 (37.14%), Postives = 80/140 (57.14%), Query Frame = 1
BLAST of Csa3G146700 vs. TAIR10
Match: AT5G10000.1 (AT5G10000.1 ferredoxin 4) HSP 1 Score: 77.8 bits (190), Expect = 6.1e-15 Identity = 39/91 (42.86%), Postives = 55/91 (60.44%), Query Frame = 1
BLAST of Csa3G146700 vs. TAIR10
Match: AT1G60950.1 (AT1G60950.1 2Fe-2S ferredoxin-like superfamily protein) HSP 1 Score: 77.8 bits (190), Expect = 6.1e-15 Identity = 40/102 (39.22%), Postives = 63/102 (61.76%), Query Frame = 1
BLAST of Csa3G146700 vs. NCBI nr
Match: gi|449432700|ref|XP_004134137.1| (PREDICTED: ferredoxin-1 [Cucumis sativus]) HSP 1 Score: 288.9 bits (738), Expect = 5.0e-75 Identity = 144/144 (100.00%), Postives = 144/144 (100.00%), Query Frame = 1
BLAST of Csa3G146700 vs. NCBI nr
Match: gi|659076437|ref|XP_008438679.1| (PREDICTED: ferredoxin, root R-B2 [Cucumis melo]) HSP 1 Score: 283.9 bits (725), Expect = 1.6e-73 Identity = 141/144 (97.92%), Postives = 142/144 (98.61%), Query Frame = 1
BLAST of Csa3G146700 vs. NCBI nr
Match: gi|703078552|ref|XP_010090921.1| (Ferredoxin-3 [Morus notabilis]) HSP 1 Score: 211.8 bits (538), Expect = 7.7e-52 Identity = 106/146 (72.60%), Postives = 127/146 (86.99%), Query Frame = 1
BLAST of Csa3G146700 vs. NCBI nr
Match: gi|225432672|ref|XP_002282517.1| (PREDICTED: ferredoxin, root R-B2 [Vitis vinifera]) HSP 1 Score: 208.4 bits (529), Expect = 8.5e-51 Identity = 106/147 (72.11%), Postives = 123/147 (83.67%), Query Frame = 1
BLAST of Csa3G146700 vs. NCBI nr
Match: gi|297737056|emb|CBI26257.3| (unnamed protein product [Vitis vinifera]) HSP 1 Score: 208.4 bits (529), Expect = 8.5e-51 Identity = 106/147 (72.11%), Postives = 123/147 (83.67%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|