Csa3G104940 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCTGCTGCAACCAGGGGTTCTCAGAGAGCGAGCAACGTGGCAATAGGAATGAAGAAATGACTATGACTACGACAACAGTAGCGACGACGATGGTGGCCGATCCTGAGGAGCGGAATCGTCAGCTTCAAATGGCGATGGAGAAATTGACGAAGCCATCGGCATATTATAATTGTGAAGAGAATGATGAGTCTCCATCGACGTTAAGCGAATGCACGATATGTTTAGAGGATCTTGGAGAAAGAGTTTCATGTCGAGTTTTTCCTAATTGCAAGCATATATTCCATACACATTGCATAATCAATTGGTTAGAGATTAATCAAACTTGTCCGATATGTAGGACTAAGTTGTAATCCAACAACTACTCCAACTCGAGTATAGCTCAACCGATTAACGCACGTACATTTAATCTAGGTTACAAATTCATGTTGAACTAA ATGCTGCTGCAACCAGGGGAGCGGAATCGTCAGCTTCAAATGGCGATGGAGAAATTGACGAAGCCATCGGCATATTATAATTGTGAAGAGAATGATGAGTCTCCATCGACGTTAAGCGAATGCACGATATGTTTAGAGGATCTTGGAGAAAGAGTTTCATGTCGAGTTTTTCCTAATTGCAAGCATATATTCCATACACATTGCATAATCAATTGGTTAGAGATTAATCAAACTTGTCCGATATCTCAACCGATTAACGCACGTACATTTAATCTAGGTTACAAATTCATGTTGAACTAA ATGCTGCTGCAACCAGGGGAGCGGAATCGTCAGCTTCAAATGGCGATGGAGAAATTGACGAAGCCATCGGCATATTATAATTGTGAAGAGAATGATGAGTCTCCATCGACGTTAAGCGAATGCACGATATGTTTAGAGGATCTTGGAGAAAGAGTTTCATGTCGAGTTTTTCCTAATTGCAAGCATATATTCCATACACATTGCATAATCAATTGGTTAGAGATTAATCAAACTTGTCCGATATCTCAACCGATTAACGCACGTACATTTAATCTAGGTTACAAATTCATGTTGAACTAA MLLQPGERNRQLQMAMEKLTKPSAYYNCEENDESPSTLSECTICLEDLGERVSCRVFPNCKHIFHTHCIINWLEINQTCPISQPINARTFNLGYKFMLN*
BLAST of Csa3G104940 vs. Swiss-Prot
Match: ATL40_ARATH (RING-H2 finger protein ATL40 OS=Arabidopsis thaliana GN=ATL40 PE=2 SV=1) HSP 1 Score: 57.4 bits (137), Expect = 1.1e-07 Identity = 20/43 (46.51%), Postives = 26/43 (60.47%), Query Frame = 1
BLAST of Csa3G104940 vs. Swiss-Prot
Match: ATL19_ARATH (Putative RING-H2 finger protein ATL19 OS=Arabidopsis thaliana GN=ATL19 PE=3 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 1.4e-07 Identity = 25/54 (46.30%), Postives = 29/54 (53.70%), Query Frame = 1
BLAST of Csa3G104940 vs. Swiss-Prot
Match: ATL17_ARATH (RING-H2 finger protein ATL17 OS=Arabidopsis thaliana GN=ATL17 PE=2 SV=2) HSP 1 Score: 56.2 bits (134), Expect = 2.3e-07 Identity = 20/42 (47.62%), Postives = 25/42 (59.52%), Query Frame = 1
BLAST of Csa3G104940 vs. Swiss-Prot
Match: ATL6_ARATH (E3 ubiquitin-protein ligase ATL6 OS=Arabidopsis thaliana GN=ATL6 PE=1 SV=2) HSP 1 Score: 55.8 bits (133), Expect = 3.1e-07 Identity = 23/62 (37.10%), Postives = 33/62 (53.23%), Query Frame = 1
BLAST of Csa3G104940 vs. Swiss-Prot
Match: ATL41_ARATH (E3 ubiquitin-protein ligase ATL41 OS=Arabidopsis thaliana GN=ATL41 PE=1 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 3.1e-07 Identity = 22/50 (44.00%), Postives = 27/50 (54.00%), Query Frame = 1
BLAST of Csa3G104940 vs. TrEMBL
Match: A0A0A0L7Y8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G104940 PE=4 SV=1) HSP 1 Score: 214.9 bits (546), Expect = 4.4e-53 Identity = 99/99 (100.00%), Postives = 99/99 (100.00%), Query Frame = 1
BLAST of Csa3G104940 vs. TrEMBL
Match: V4WEW6_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10010182mg PE=4 SV=1) HSP 1 Score: 75.9 bits (185), Expect = 3.2e-11 Identity = 36/76 (47.37%), Postives = 44/76 (57.89%), Query Frame = 1
BLAST of Csa3G104940 vs. TrEMBL
Match: A0A067FG84_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g035583mg PE=4 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 4.2e-11 Identity = 36/76 (47.37%), Postives = 44/76 (57.89%), Query Frame = 1
BLAST of Csa3G104940 vs. TrEMBL
Match: V4URL5_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10010737mg PE=4 SV=1) HSP 1 Score: 70.9 bits (172), Expect = 1.0e-09 Identity = 34/75 (45.33%), Postives = 43/75 (57.33%), Query Frame = 1
BLAST of Csa3G104940 vs. TrEMBL
Match: A0A0D2M7R2_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_002G070700 PE=4 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 1.7e-09 Identity = 34/69 (49.28%), Postives = 43/69 (62.32%), Query Frame = 1
BLAST of Csa3G104940 vs. TAIR10
Match: AT2G42350.1 (AT2G42350.1 RING/U-box superfamily protein) HSP 1 Score: 57.4 bits (137), Expect = 5.9e-09 Identity = 20/43 (46.51%), Postives = 26/43 (60.47%), Query Frame = 1
BLAST of Csa3G104940 vs. TAIR10
Match: AT1G53010.1 (AT1G53010.1 RING/U-box superfamily protein) HSP 1 Score: 57.0 bits (136), Expect = 7.7e-09 Identity = 25/54 (46.30%), Postives = 29/54 (53.70%), Query Frame = 1
BLAST of Csa3G104940 vs. TAIR10
Match: AT3G05200.1 (AT3G05200.1 RING/U-box superfamily protein) HSP 1 Score: 55.8 bits (133), Expect = 1.7e-08 Identity = 23/62 (37.10%), Postives = 33/62 (53.23%), Query Frame = 1
BLAST of Csa3G104940 vs. TAIR10
Match: AT2G42360.1 (AT2G42360.1 RING/U-box superfamily protein) HSP 1 Score: 55.8 bits (133), Expect = 1.7e-08 Identity = 22/50 (44.00%), Postives = 27/50 (54.00%), Query Frame = 1
BLAST of Csa3G104940 vs. TAIR10
Match: AT2G35910.1 (AT2G35910.1 RING/U-box superfamily protein) HSP 1 Score: 55.5 bits (132), Expect = 2.2e-08 Identity = 22/49 (44.90%), Postives = 28/49 (57.14%), Query Frame = 1
BLAST of Csa3G104940 vs. NCBI nr
Match: gi|700201108|gb|KGN56241.1| (hypothetical protein Csa_3G104940 [Cucumis sativus]) HSP 1 Score: 214.9 bits (546), Expect = 6.3e-53 Identity = 99/99 (100.00%), Postives = 99/99 (100.00%), Query Frame = 1
BLAST of Csa3G104940 vs. NCBI nr
Match: gi|778688398|ref|XP_011652743.1| (PREDICTED: uncharacterized protein LOC105435076 [Cucumis sativus]) HSP 1 Score: 170.2 bits (430), Expect = 1.8e-39 Identity = 77/81 (95.06%), Postives = 78/81 (96.30%), Query Frame = 1
BLAST of Csa3G104940 vs. NCBI nr
Match: gi|659102865|ref|XP_008452355.1| (PREDICTED: putative RING-H2 finger protein ATL19, partial [Cucumis melo]) HSP 1 Score: 161.4 bits (407), Expect = 8.3e-37 Identity = 71/80 (88.75%), Postives = 77/80 (96.25%), Query Frame = 1
BLAST of Csa3G104940 vs. NCBI nr
Match: gi|567919746|ref|XP_006451879.1| (hypothetical protein CICLE_v10010182mg [Citrus clementina]) HSP 1 Score: 75.9 bits (185), Expect = 4.6e-11 Identity = 36/76 (47.37%), Postives = 44/76 (57.89%), Query Frame = 1
BLAST of Csa3G104940 vs. NCBI nr
Match: gi|641843578|gb|KDO62477.1| (hypothetical protein CISIN_1g035583mg [Citrus sinensis]) HSP 1 Score: 75.5 bits (184), Expect = 6.0e-11 Identity = 36/76 (47.37%), Postives = 44/76 (57.89%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|