Csa2G068690 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ATGTGGGAAAATCGAAAACTCATTTTGCTTGAAACTGTATTTCTCTAGCATTACTTTTCTATGCAGTGCATGTTCTAAATGGTTTCTTTCACTAAGAAGGACTAAATAACATACTACATTCTAAAGTAAAGTTCCTCAAATTTGCCAGTATCATGATCCGGGTGCTGAACTTTTATGTTCCTGGTTTTACATTGTAATAATGACTTTCTTGATACAGGGAGCAAGTTTCTCAGAGGTGATTCAAATGACAGATATTTTCGAGGGTAGCATCATTCGAAGTGCTAGACGGCTTGATGAATTCTTGAATCAGGTGCAGACGAATAACATATAGATTTACATATTTTCTGTCTTACTCTTGGTTGAAACCCTGAACCTGTTTCAGTTTTCAAAGACCTAGGAAAGTCATGTTTGGATTTTATATATTTGTCACAGAAATAAAGAAGCTTGGGCTTTTGGGATCCCCGAATAATAGGGTTTATGCTTCTTTTTCTATGGGATTCCTCTATCATGTTCAGGCTCTTTATTATTACTTTTTTAATTCAGTTGCGTGCTGCTGCCAATGCTGTGGGGGAGGTAAACTTAGAGAGCAAGTTTTCTGCAGCCAGTGAAAGCCTTCGCAGAGGTATAATGTTCGCAAACTCACTCTATTTGTAGATTGTCCCCTGCTTTGGTTGCATCTTCAGGGGTTCATGAAGCTCTGAGATTGTGGTTTTCACCAACCATTTTTCATAGAGGTATTTTCTCTATTTTCCATGTTTAAGATGTACTGGAATACAAATTTTTGGATATTTTAGCATAAACTAGAAA ATGTGGGAAAATCGAAAACTCATTTTGCTTGAAACTGGAGCAAGTTTCTCAGAGGTGATTCAAATGACAGATATTTTCGAGGGTAGCATCATTCGAAGTGCTAGACGGCTTGATGAATTCTTGAATCAGTTGCGTGCTGCTGCCAATGCTGTGGGGGAGGTAAACTTAGAGAGCAAGTTTTCTGCAGCCAGTGAAAGCCTTCGCAGAGGTATAATGTTCGCAAACTCACTCTATTTGTAG ATGTGGGAAAATCGAAAACTCATTTTGCTTGAAACTGGAGCAAGTTTCTCAGAGGTGATTCAAATGACAGATATTTTCGAGGGTAGCATCATTCGAAGTGCTAGACGGCTTGATGAATTCTTGAATCAGTTGCGTGCTGCTGCCAATGCTGTGGGGGAGGTAAACTTAGAGAGCAAGTTTTCTGCAGCCAGTGAAAGCCTTCGCAGAGGTATAATGTTCGCAAACTCACTCTATTTGTAG MWENRKLILLETGASFSEVIQMTDIFEGSIIRSARRLDEFLNQLRAAANAVGEVNLESKFSAASESLRRGIMFANSLYL*
BLAST of Csa2G068690 vs. Swiss-Prot
Match: HEN2_ARATH (DExH-box ATP-dependent RNA helicase DExH10 OS=Arabidopsis thaliana GN=HEN2 PE=1 SV=2) HSP 1 Score: 118.2 bits (295), Expect = 4.0e-26 Identity = 61/67 (91.04%), Postives = 63/67 (94.03%), Query Frame = 1
BLAST of Csa2G068690 vs. Swiss-Prot
Match: SK2L2_HUMAN (Superkiller viralicidic activity 2-like 2 OS=Homo sapiens GN=SKIV2L2 PE=1 SV=3) HSP 1 Score: 75.5 bits (184), Expect = 3.0e-13 Identity = 36/68 (52.94%), Postives = 47/68 (69.12%), Query Frame = 1
BLAST of Csa2G068690 vs. Swiss-Prot
Match: SK2L2_MOUSE (Superkiller viralicidic activity 2-like 2 OS=Mus musculus GN=Skiv2l2 PE=1 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 3.0e-13 Identity = 36/68 (52.94%), Postives = 47/68 (69.12%), Query Frame = 1
BLAST of Csa2G068690 vs. Swiss-Prot
Match: MTR4_CAEEL (mRNA transport homolog 4 OS=Caenorhabditis elegans GN=mtr-4 PE=3 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 1.1e-12 Identity = 36/67 (53.73%), Postives = 48/67 (71.64%), Query Frame = 1
BLAST of Csa2G068690 vs. Swiss-Prot
Match: MTR4_ARATH (DExH-box ATP-dependent RNA helicase DExH9 OS=Arabidopsis thaliana GN=MTR4 PE=2 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 6.2e-11 Identity = 32/67 (47.76%), Postives = 46/67 (68.66%), Query Frame = 1
BLAST of Csa2G068690 vs. TrEMBL
Match: A0A0A0LHE5_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G068690 PE=4 SV=1) HSP 1 Score: 151.8 bits (382), Expect = 3.6e-34 Identity = 79/79 (100.00%), Postives = 79/79 (100.00%), Query Frame = 1
BLAST of Csa2G068690 vs. TrEMBL
Match: A0A059CJH4_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_C00066 PE=4 SV=1) HSP 1 Score: 122.5 bits (306), Expect = 2.4e-25 Identity = 63/67 (94.03%), Postives = 66/67 (98.51%), Query Frame = 1
BLAST of Csa2G068690 vs. TrEMBL
Match: B9HBA6_POPTR (HUA ENHANCER 2 family protein OS=Populus trichocarpa GN=POPTR_0006s07760g PE=4 SV=1) HSP 1 Score: 122.1 bits (305), Expect = 3.1e-25 Identity = 64/67 (95.52%), Postives = 66/67 (98.51%), Query Frame = 1
BLAST of Csa2G068690 vs. TrEMBL
Match: A0A0B0P7U0_GOSAR (Superkiller viralicidic activity 2-like 2 OS=Gossypium arboreum GN=F383_08319 PE=4 SV=1) HSP 1 Score: 121.7 bits (304), Expect = 4.0e-25 Identity = 63/67 (94.03%), Postives = 66/67 (98.51%), Query Frame = 1
BLAST of Csa2G068690 vs. TrEMBL
Match: F6H9P7_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_11s0065g00340 PE=4 SV=1) HSP 1 Score: 121.3 bits (303), Expect = 5.3e-25 Identity = 62/67 (92.54%), Postives = 66/67 (98.51%), Query Frame = 1
BLAST of Csa2G068690 vs. TAIR10
Match: AT2G06990.1 (AT2G06990.1 RNA helicase, ATP-dependent, SK12/DOB1 protein) HSP 1 Score: 118.2 bits (295), Expect = 2.3e-27 Identity = 61/67 (91.04%), Postives = 63/67 (94.03%), Query Frame = 1
BLAST of Csa2G068690 vs. TAIR10
Match: AT1G59760.1 (AT1G59760.1 RNA helicase, ATP-dependent, SK12/DOB1 protein) HSP 1 Score: 67.8 bits (164), Expect = 3.5e-12 Identity = 32/67 (47.76%), Postives = 46/67 (68.66%), Query Frame = 1
BLAST of Csa2G068690 vs. TAIR10
Match: AT3G46960.1 (AT3G46960.1 RNA helicase, ATP-dependent, SK12/DOB1 protein) HSP 1 Score: 58.5 bits (140), Expect = 2.1e-09 Identity = 33/83 (39.76%), Postives = 47/83 (56.63%), Query Frame = 1
BLAST of Csa2G068690 vs. NCBI nr
Match: gi|700206079|gb|KGN61198.1| (hypothetical protein Csa_2G068690 [Cucumis sativus]) HSP 1 Score: 151.8 bits (382), Expect = 5.2e-34 Identity = 79/79 (100.00%), Postives = 79/79 (100.00%), Query Frame = 1
BLAST of Csa2G068690 vs. NCBI nr
Match: gi|449470374|ref|XP_004152892.1| (PREDICTED: superkiller viralicidic activity 2-like 2 [Cucumis sativus]) HSP 1 Score: 127.5 bits (319), Expect = 1.1e-26 Identity = 67/67 (100.00%), Postives = 67/67 (100.00%), Query Frame = 1
BLAST of Csa2G068690 vs. NCBI nr
Match: gi|659069579|ref|XP_008450745.1| (PREDICTED: superkiller viralicidic activity 2-like 2 [Cucumis melo]) HSP 1 Score: 126.3 bits (316), Expect = 2.4e-26 Identity = 66/67 (98.51%), Postives = 67/67 (100.00%), Query Frame = 1
BLAST of Csa2G068690 vs. NCBI nr
Match: gi|702288787|ref|XP_010046886.1| (PREDICTED: superkiller viralicidic activity 2-like 2 isoform X1 [Eucalyptus grandis]) HSP 1 Score: 122.5 bits (306), Expect = 3.4e-25 Identity = 63/67 (94.03%), Postives = 66/67 (98.51%), Query Frame = 1
BLAST of Csa2G068690 vs. NCBI nr
Match: gi|702288797|ref|XP_010046888.1| (PREDICTED: superkiller viralicidic activity 2-like 2 isoform X2 [Eucalyptus grandis]) HSP 1 Score: 122.5 bits (306), Expect = 3.4e-25 Identity = 63/67 (94.03%), Postives = 66/67 (98.51%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|