Csa1G001470 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: five_prime_UTRCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.CAGAAAAAAACAAATAAAAGAAATGTGAAAGGCTCATCCGTCCACGTGAAGCATCAAGATCAACGCAGTTGTCGAATCAGTGTCCAGCTTCCAAGTTTCAAAACCACTCCATTTCTTTACCCTTCTCAAATCTTCTCAACTTAAAACCACACCATCCCTATTCATCCCCAATCCCAAATCCCACTTTCTTTCTTCTTTAATCTTTAGTTTTAAGACTCATAATGGCTGATTGGGGGCCGGTGATTATAGCGGTGGTGCTCTTCGTCCTGCTCAGTCCAGGCCTTCTCTTTCAGATCCCAGCCAAAGGAAGAGTTGTTGAATTCGGAAACATGCAGACTAGTGGGGCTTCCATTTTAGTCCACGCCATCATCTACTTTGGCCTCATCACTATCTTCCTCATCGCCATCGGTGTTCATATCTACACTGGCTAAAACCCAACTCCCCTCTTCTCTTTAATCTACTCTGTACTGCCTTTTCTTTCTCTTTCTTGTTCTATAATCGATGGATTGTTGTCTGTTATGTGACTTGTGACTTTTACTGTCTAGTTGGAGTTTCAACGATTGCGATTGTAAAATTGGTTTGATTTTAAACGCGATTTATAAATTGAATGGCTGCTGTTGGGTGTTGGGTGTTGGGTGTTTGGTACAGATTCAGGGAAAAAGATTCCGATATACGATTCCCATAGGGTTTATATGACCATTTACATCTGCTTTTACCGTTTCATTCTCTTTCTCGTCGTTTGGGTTTCGATGGCCCCCG ATGGCTGATTGGGGGCCGGTGATTATAGCGGTGGTGCTCTTCGTCCTGCTCAGTCCAGGCCTTCTCTTTCAGATCCCAGCCAAAGGAAGAGTTGTTGAATTCGGAAACATGCAGACTAGTGGGGCTTCCATTTTAGTCCACGCCATCATCTACTTTGGCCTCATCACTATCTTCCTCATCGCCATCGGTGTTCATATCTACACTGGCTAA ATGGCTGATTGGGGGCCGGTGATTATAGCGGTGGTGCTCTTCGTCCTGCTCAGTCCAGGCCTTCTCTTTCAGATCCCAGCCAAAGGAAGAGTTGTTGAATTCGGAAACATGCAGACTAGTGGGGCTTCCATTTTAGTCCACGCCATCATCTACTTTGGCCTCATCACTATCTTCCTCATCGCCATCGGTGTTCATATCTACACTGGCTAA MADWGPVIIAVVLFVLLSPGLLFQIPAKGRVVEFGNMQTSGASILVHAIIYFGLITIFLIAIGVHIYTG*
BLAST of Csa1G001470 vs. TrEMBL
Match: A0A0A0LNK0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G001470 PE=4 SV=1) HSP 1 Score: 137.9 bits (346), Expect = 4.8e-30 Identity = 69/69 (100.00%), Postives = 69/69 (100.00%), Query Frame = 1
BLAST of Csa1G001470 vs. TrEMBL
Match: I1K6N1_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_05G204400 PE=4 SV=1) HSP 1 Score: 133.7 bits (335), Expect = 9.0e-29 Identity = 65/69 (94.20%), Postives = 68/69 (98.55%), Query Frame = 1
BLAST of Csa1G001470 vs. TrEMBL
Match: A0A0B2QV82_GLYSO (Uncharacterized protein OS=Glycine soja GN=glysoja_039124 PE=4 SV=1) HSP 1 Score: 133.7 bits (335), Expect = 9.0e-29 Identity = 65/69 (94.20%), Postives = 68/69 (98.55%), Query Frame = 1
BLAST of Csa1G001470 vs. TrEMBL
Match: Q7X9E3_PHAVU (Uncharacterized protein OS=Phaseolus vulgaris GN=PHAVU_002G286200g PE=2 SV=1) HSP 1 Score: 133.3 bits (334), Expect = 1.2e-28 Identity = 64/69 (92.75%), Postives = 68/69 (98.55%), Query Frame = 1
BLAST of Csa1G001470 vs. TrEMBL
Match: A0A151RRH0_CAJCA (Uncharacterized protein OS=Cajanus cajan GN=KK1_033353 PE=4 SV=1) HSP 1 Score: 133.3 bits (334), Expect = 1.2e-28 Identity = 64/69 (92.75%), Postives = 68/69 (98.55%), Query Frame = 1
BLAST of Csa1G001470 vs. TAIR10
Match: AT5G63500.1 (AT5G63500.1 Protein of unknown function (DUF 3339)) HSP 1 Score: 125.6 bits (314), Expect = 1.2e-29 Identity = 61/69 (88.41%), Postives = 64/69 (92.75%), Query Frame = 1
BLAST of Csa1G001470 vs. TAIR10
Match: AT3G48660.1 (AT3G48660.1 Protein of unknown function (DUF 3339)) HSP 1 Score: 125.2 bits (313), Expect = 1.6e-29 Identity = 59/69 (85.51%), Postives = 64/69 (92.75%), Query Frame = 1
BLAST of Csa1G001470 vs. TAIR10
Match: AT5G40980.1 (AT5G40980.1 Protein of unknown function (DUF 3339)) HSP 1 Score: 105.9 bits (263), Expect = 1.0e-23 Identity = 49/66 (74.24%), Postives = 57/66 (86.36%), Query Frame = 1
BLAST of Csa1G001470 vs. TAIR10
Match: AT3G27027.1 (AT3G27027.1 Protein of unknown function (DUF 3339)) HSP 1 Score: 101.3 bits (251), Expect = 2.5e-22 Identity = 47/65 (72.31%), Postives = 55/65 (84.62%), Query Frame = 1
BLAST of Csa1G001470 vs. TAIR10
Match: AT3G01940.1 (AT3G01940.1 Protein of unknown function (DUF 3339)) HSP 1 Score: 100.5 bits (249), Expect = 4.3e-22 Identity = 47/66 (71.21%), Postives = 56/66 (84.85%), Query Frame = 1
BLAST of Csa1G001470 vs. NCBI nr
Match: gi|449440538|ref|XP_004138041.1| (PREDICTED: uncharacterized protein LOC101212373 [Cucumis sativus]) HSP 1 Score: 137.9 bits (346), Expect = 6.8e-30 Identity = 69/69 (100.00%), Postives = 69/69 (100.00%), Query Frame = 1
BLAST of Csa1G001470 vs. NCBI nr
Match: gi|1012094223|ref|XP_015955605.1| (PREDICTED: uncharacterized protein LOC107479995 [Arachis duranensis]) HSP 1 Score: 134.0 bits (336), Expect = 9.9e-29 Identity = 65/69 (94.20%), Postives = 68/69 (98.55%), Query Frame = 1
BLAST of Csa1G001470 vs. NCBI nr
Match: gi|356513423|ref|XP_003525413.1| (PREDICTED: uncharacterized protein LOC100805083 [Glycine max]) HSP 1 Score: 133.7 bits (335), Expect = 1.3e-28 Identity = 65/69 (94.20%), Postives = 68/69 (98.55%), Query Frame = 1
BLAST of Csa1G001470 vs. NCBI nr
Match: gi|802770909|ref|XP_012090676.1| (PREDICTED: uncharacterized protein LOC105648784 [Jatropha curcas]) HSP 1 Score: 133.3 bits (334), Expect = 1.7e-28 Identity = 64/69 (92.75%), Postives = 68/69 (98.55%), Query Frame = 1
BLAST of Csa1G001470 vs. NCBI nr
Match: gi|593793969|ref|XP_007160023.1| (hypothetical protein PHAVU_002G286200g [Phaseolus vulgaris]) HSP 1 Score: 133.3 bits (334), Expect = 1.7e-28 Identity = 64/69 (92.75%), Postives = 68/69 (98.55%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|