Cp4.1LG14g01390 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGACATTGTTGGGTTTGCAGGCAATGGCTCAAGTAGGCGGTCTAGTTATGCTGCAACCAGAGGTGGGAGGCTCACGCGACAACTTCTTCTTCGCTGGAATCGACAAAGTGAGGTTCCGAAAACCCGTGATTGCAGGAGACACATTGGTGATGCGAATGACTCTTGTTAAGTTGCAGAAGAAGTTCGGAATTGCCAAAATGGAAGGGAAGGCGTACGTCGGAGGCGAAGTCGTGTGCGAAGGTGAGTTCTTGATGGCCATGGGTAAAGAAGAATGA ATGACATTGTTGGGTTTGCAGGCAATGGCTCAAGTAGGCGGTCTAGTTATGCTGCAACCAGAGGTGGGAGGCTCACGCGACAACTTCTTCTTCGCTGGAATCGACAAAGTGAGGTTCCGAAAACCCGTGATTGCAGGAGACACATTGGTGATGCGAATGACTCTTGTTAAGTTGCAGAAGAAGTTCGGAATTGCCAAAATGGAAGGGAAGGCGTACGTCGGAGGCGAAGTCGTGTGCGAAGGTGAGTTCTTGATGGCCATGGGTAAAGAAGAATGA ATGACATTGTTGGGTTTGCAGGCAATGGCTCAAGTAGGCGGTCTAGTTATGCTGCAACCAGAGGTGGGAGGCTCACGCGACAACTTCTTCTTCGCTGGAATCGACAAAGTGAGGTTCCGAAAACCCGTGATTGCAGGAGACACATTGGTGATGCGAATGACTCTTGTTAAGTTGCAGAAGAAGTTCGGAATTGCCAAAATGGAAGGGAAGGCGTACGTCGGAGGCGAAGTCGTGTGCGAAGGTGAGTTCTTGATGGCCATGGGTAAAGAAGAATGA MTLLGLQAMAQVGGLVMLQPEVGGSRDNFFFAGIDKVRFRKPVIAGDTLVMRMTLVKLQKKFGIAKMEGKAYVGGEVVCEGEFLMAMGKEE
BLAST of Cp4.1LG14g01390 vs. Swiss-Prot
Match: FABZ_THEEB (3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ OS=Thermosynechococcus elongatus (strain BP-1) GN=fabZ PE=3 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 3.4e-13 Identity = 40/86 (46.51%), Postives = 64/86 (74.42%), Query Frame = 1
BLAST of Cp4.1LG14g01390 vs. Swiss-Prot
Match: FABZ_SYNP2 (3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=fabZ PE=3 SV=1) HSP 1 Score: 74.7 bits (182), Expect = 5.8e-13 Identity = 42/85 (49.41%), Postives = 60/85 (70.59%), Query Frame = 1
BLAST of Cp4.1LG14g01390 vs. Swiss-Prot
Match: FABZ_SYNY3 (3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabZ PE=3 SV=2) HSP 1 Score: 74.3 bits (181), Expect = 7.6e-13 Identity = 44/88 (50.00%), Postives = 63/88 (71.59%), Query Frame = 1
BLAST of Cp4.1LG14g01390 vs. Swiss-Prot
Match: LPXZ_CHLTE (Bifunctional enzyme LpxC/FabZ OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=lpxC/fabZ PE=3 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 4.9e-12 Identity = 35/82 (42.68%), Postives = 52/82 (63.41%), Query Frame = 1
BLAST of Cp4.1LG14g01390 vs. Swiss-Prot
Match: FABZ_ANAVT (3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=fabZ PE=3 SV=2) HSP 1 Score: 70.9 bits (172), Expect = 8.4e-12 Identity = 42/87 (48.28%), Postives = 61/87 (70.11%), Query Frame = 1
BLAST of Cp4.1LG14g01390 vs. TrEMBL
Match: F2VYC9_HELAN (Beta-hydroxyacyl-ACP dehydratase OS=Helianthus annuus GN=HAAD1 PE=2 SV=1) HSP 1 Score: 164.5 bits (415), Expect = 6.2e-38 Identity = 81/89 (91.01%), Postives = 86/89 (96.63%), Query Frame = 1
BLAST of Cp4.1LG14g01390 vs. TrEMBL
Match: D9J166_HEVBR (Beta-hydroxyacyl-acyl carrier protein dehydratase OS=Hevea brasiliensis PE=2 SV=1) HSP 1 Score: 163.7 bits (413), Expect = 1.1e-37 Identity = 81/88 (92.05%), Postives = 86/88 (97.73%), Query Frame = 1
BLAST of Cp4.1LG14g01390 vs. TrEMBL
Match: A0A151T0I3_CAJCA ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase OS=Cajanus cajan GN=KK1_022956 PE=4 SV=1) HSP 1 Score: 163.7 bits (413), Expect = 1.1e-37 Identity = 81/85 (95.29%), Postives = 83/85 (97.65%), Query Frame = 1
BLAST of Cp4.1LG14g01390 vs. TrEMBL
Match: A0A067JPG4_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_22886 PE=3 SV=1) HSP 1 Score: 163.3 bits (412), Expect = 1.4e-37 Identity = 80/88 (90.91%), Postives = 86/88 (97.73%), Query Frame = 1
BLAST of Cp4.1LG14g01390 vs. TrEMBL
Match: A0A0M3Q196_JATCU (Hydroxyacyl-ACP dehydratase OS=Jatropha curcas PE=2 SV=1) HSP 1 Score: 163.3 bits (412), Expect = 1.4e-37 Identity = 80/88 (90.91%), Postives = 86/88 (97.73%), Query Frame = 1
BLAST of Cp4.1LG14g01390 vs. TAIR10
Match: AT5G10160.1 (AT5G10160.1 Thioesterase superfamily protein) HSP 1 Score: 161.4 bits (407), Expect = 2.6e-40 Identity = 80/89 (89.89%), Postives = 85/89 (95.51%), Query Frame = 1
BLAST of Cp4.1LG14g01390 vs. TAIR10
Match: AT2G22230.1 (AT2G22230.1 Thioesterase superfamily protein) HSP 1 Score: 147.5 bits (371), Expect = 4.0e-36 Identity = 70/83 (84.34%), Postives = 80/83 (96.39%), Query Frame = 1
BLAST of Cp4.1LG14g01390 vs. NCBI nr
Match: gi|302634224|gb|ADL60215.1| (beta-hydroxyacyl-ACP dehydratase [Helianthus annuus]) HSP 1 Score: 164.5 bits (415), Expect = 8.9e-38 Identity = 81/89 (91.01%), Postives = 86/89 (96.63%), Query Frame = 1
BLAST of Cp4.1LG14g01390 vs. NCBI nr
Match: gi|1012349359|gb|KYP60549.1| ((3R)-hydroxymyristoyl-[acyl-carrier-protein]) HSP 1 Score: 163.7 bits (413), Expect = 1.5e-37 Identity = 81/85 (95.29%), Postives = 83/85 (97.65%), Query Frame = 1
BLAST of Cp4.1LG14g01390 vs. NCBI nr
Match: gi|299150759|gb|ADJ17723.1| (beta-hydroxyacyl-acyl carrier protein dehydratase [Hevea brasiliensis]) HSP 1 Score: 163.7 bits (413), Expect = 1.5e-37 Identity = 81/88 (92.05%), Postives = 86/88 (97.73%), Query Frame = 1
BLAST of Cp4.1LG14g01390 vs. NCBI nr
Match: gi|802732305|ref|XP_012086368.1| (PREDICTED: uncharacterized protein LOC105645386 [Jatropha curcas]) HSP 1 Score: 163.3 bits (412), Expect = 2.0e-37 Identity = 80/88 (90.91%), Postives = 86/88 (97.73%), Query Frame = 1
BLAST of Cp4.1LG14g01390 vs. NCBI nr
Match: gi|924434384|gb|ALB76802.1| (hydroxyacyl-ACP dehydratase [Jatropha curcas]) HSP 1 Score: 163.3 bits (412), Expect = 2.0e-37 Identity = 80/88 (90.91%), Postives = 86/88 (97.73%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|