Cp4.1LG07g09600 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAGAAGGGAGGGATTAAGTGCAGGTTGGAAGAGAAGCAAGAAGGAAAGAGGTCAAAAGAAAGCATGATTTCGGGGACGGTGGCGGCCGTGGCGACGACGGTGGTGGCAATGGCGGGGCCGGCGGTGGCGCTGGTGGATGAAAGGTTGAGCACAGAAGGAACAGGGCTGCCCTTTGGTTTGAGCAACAACCTTCTTGGGTGGATTCTGGCAGGGATGTTTGGTTTCATTTGGGCTCTTTATTTTGTTTATGCTTCATCCTTGGAGGAGGATGAAGATTCTGGTTTGTCACTTTGA ATGAAGAAGGGAGGGATTAAGTGCAGGTTGGAAGAGAAGCAAGAAGGAAAGAGGTCAAAAGAAAGCATGATTTCGGGGACGGTGGCGGCCGTGGCGACGACGGTGGTGGCAATGGCGGGGCCGGCGGTGGCGCTGGTGGATGAAAGGTTGAGCACAGAAGGAACAGGGCTGCCCTTTGGTTTGAGCAACAACCTTCTTGGGTGGATTCTGGCAGGGATGTTTGGTTTCATTTGGGCTCTTTATTTTGTTTATGCTTCATCCTTGGAGGAGGATGAAGATTCTGGTTTGTCACTTTGA ATGAAGAAGGGAGGGATTAAGTGCAGGTTGGAAGAGAAGCAAGAAGGAAAGAGGTCAAAAGAAAGCATGATTTCGGGGACGGTGGCGGCCGTGGCGACGACGGTGGTGGCAATGGCGGGGCCGGCGGTGGCGCTGGTGGATGAAAGGTTGAGCACAGAAGGAACAGGGCTGCCCTTTGGTTTGAGCAACAACCTTCTTGGGTGGATTCTGGCAGGGATGTTTGGTTTCATTTGGGCTCTTTATTTTGTTTATGCTTCATCCTTGGAGGAGGATGAAGATTCTGGTTTGTCACTTTGA MKKGGIKCRLEEKQEGKRSKESMISGTVAAVATTVVAMAGPAVALVDERLSTEGTGLPFGLSNNLLGWILAGMFGFIWALYFVYASSLEEDEDSGLSL
BLAST of Cp4.1LG07g09600 vs. Swiss-Prot
Match: PSBW_ARATH (Photosystem II reaction center W protein, chloroplastic OS=Arabidopsis thaliana GN=PSBW PE=1 SV=2) HSP 1 Score: 118.2 bits (295), Expect = 4.9e-26 Identity = 61/97 (62.89%), Postives = 72/97 (74.23%), Query Frame = 1
BLAST of Cp4.1LG07g09600 vs. Swiss-Prot
Match: PSBW_SPIOL (Photosystem II reaction center W protein, chloroplastic OS=Spinacia oleracea GN=psbW PE=1 SV=1) HSP 1 Score: 110.5 bits (275), Expect = 1.0e-23 Identity = 60/101 (59.41%), Postives = 74/101 (73.27%), Query Frame = 1
BLAST of Cp4.1LG07g09600 vs. Swiss-Prot
Match: PSBW_ORYSJ (Photosystem II reaction center W protein, chloroplastic OS=Oryza sativa subsp. japonica GN=PSBW PE=2 SV=1) HSP 1 Score: 93.2 bits (230), Expect = 1.7e-18 Identity = 51/94 (54.26%), Postives = 65/94 (69.15%), Query Frame = 1
BLAST of Cp4.1LG07g09600 vs. Swiss-Prot
Match: PSBW_CHLRE (Photosystem II reaction center W protein, chloroplastic OS=Chlamydomonas reinhardtii GN=psbW PE=1 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 7.6e-11 Identity = 36/80 (45.00%), Postives = 54/80 (67.50%), Query Frame = 1
BLAST of Cp4.1LG07g09600 vs. TrEMBL
Match: A0A0A0LJA2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G010330 PE=4 SV=1) HSP 1 Score: 151.8 bits (382), Expect = 4.5e-34 Identity = 80/99 (80.81%), Postives = 87/99 (87.88%), Query Frame = 1
BLAST of Cp4.1LG07g09600 vs. TrEMBL
Match: A0A151S335_CAJCA (Uncharacterized protein OS=Cajanus cajan GN=KK1_029055 PE=4 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 2.6e-26 Identity = 65/97 (67.01%), Postives = 76/97 (78.35%), Query Frame = 1
BLAST of Cp4.1LG07g09600 vs. TrEMBL
Match: A0A061F2Y4_THECC (Photosystem II reaction center W protein, chloroplastic, putative OS=Theobroma cacao GN=TCM_026321 PE=4 SV=1) HSP 1 Score: 125.6 bits (314), Expect = 3.4e-26 Identity = 64/97 (65.98%), Postives = 74/97 (76.29%), Query Frame = 1
BLAST of Cp4.1LG07g09600 vs. TrEMBL
Match: A0A0B0NI36_GOSAR (Photosystem II reaction center W, chloroplastic OS=Gossypium arboreum GN=F383_03690 PE=4 SV=1) HSP 1 Score: 124.8 bits (312), Expect = 5.8e-26 Identity = 65/97 (67.01%), Postives = 73/97 (75.26%), Query Frame = 1
BLAST of Cp4.1LG07g09600 vs. TrEMBL
Match: C6SWM3_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_10G032200 PE=2 SV=1) HSP 1 Score: 124.0 bits (310), Expect = 1.0e-25 Identity = 67/99 (67.68%), Postives = 75/99 (75.76%), Query Frame = 1
BLAST of Cp4.1LG07g09600 vs. TAIR10
Match: AT2G30570.1 (AT2G30570.1 photosystem II reaction center W) HSP 1 Score: 118.2 bits (295), Expect = 2.8e-27 Identity = 61/97 (62.89%), Postives = 72/97 (74.23%), Query Frame = 1
BLAST of Cp4.1LG07g09600 vs. NCBI nr
Match: gi|659070655|ref|XP_008456049.1| (PREDICTED: photosystem II reaction center W protein, chloroplastic-like isoform X1 [Cucumis melo]) HSP 1 Score: 160.2 bits (404), Expect = 1.8e-36 Identity = 81/98 (82.65%), Postives = 89/98 (90.82%), Query Frame = 1
BLAST of Cp4.1LG07g09600 vs. NCBI nr
Match: gi|659070657|ref|XP_008456055.1| (PREDICTED: photosystem II reaction center W protein, chloroplastic-like isoform X2 [Cucumis melo]) HSP 1 Score: 160.2 bits (404), Expect = 1.8e-36 Identity = 81/98 (82.65%), Postives = 89/98 (90.82%), Query Frame = 1
BLAST of Cp4.1LG07g09600 vs. NCBI nr
Match: gi|449442939|ref|XP_004139238.1| (PREDICTED: photosystem II reaction center W protein, chloroplastic [Cucumis sativus]) HSP 1 Score: 151.8 bits (382), Expect = 6.4e-34 Identity = 80/99 (80.81%), Postives = 87/99 (87.88%), Query Frame = 1
BLAST of Cp4.1LG07g09600 vs. NCBI nr
Match: gi|1012337953|gb|KYP49216.1| (hypothetical protein KK1_029055 [Cajanus cajan]) HSP 1 Score: 125.9 bits (315), Expect = 3.8e-26 Identity = 65/97 (67.01%), Postives = 76/97 (78.35%), Query Frame = 1
BLAST of Cp4.1LG07g09600 vs. NCBI nr
Match: gi|727476866|ref|XP_010414250.1| (PREDICTED: photosystem II reaction center W protein, chloroplastic [Camelina sativa]) HSP 1 Score: 125.6 bits (314), Expect = 4.9e-26 Identity = 66/98 (67.35%), Postives = 77/98 (78.57%), Query Frame = 1
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|