Cp4.1LG01g22170 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGATCATTGGCCGCCTCCGCCTCCGCCATGAAAACCGGCCATTACCACTTCTGGAACACTTCAGTACCTTATCTCTTCGGCGCAATAACGCTAACTCTGCTTCTCATCCTCACCGCATTGATTTTCCTCGTTTGCTCTTGCCGGAAACACTCTTCTTCTTCCGACGAAGAAGACCAGAAGACGAAGATCGATACGCCATCAGTAGCGGCGGACGATCCACAACCTAAAATCGTCGTCATAATGGCTGGAAATCACACGCCGACCTTCCTCGCTACTGCTACGCCTTCCGATTCTTCTAATTTCTCCCGATCGACAGAGCGGTTTTGA ATGAGATCATTGGCCGCCTCCGCCTCCGCCATGAAAACCGGCCATTACCACTTCTGGAACACTTCAGTACCTTATCTCTTCGGCGCAATAACGCTAACTCTGCTTCTCATCCTCACCGCATTGATTTTCCTCGTTTGCTCTTGCCGGAAACACTCTTCTTCTTCCGACGAAGAAGACCAGAAGACGAAGATCGATACGCCATCAGTAGCGGCGGACGATCCACAACCTAAAATCGTCGTCATAATGGCTGGAAATCACACGCCGACCTTCCTCGCTACTGCTACGCCTTCCGATTCTTCTAATTTCTCCCGATCGACAGAGCGGTTTTGA ATGAGATCATTGGCCGCCTCCGCCTCCGCCATGAAAACCGGCCATTACCACTTCTGGAACACTTCAGTACCTTATCTCTTCGGCGCAATAACGCTAACTCTGCTTCTCATCCTCACCGCATTGATTTTCCTCGTTTGCTCTTGCCGGAAACACTCTTCTTCTTCCGACGAAGAAGACCAGAAGACGAAGATCGATACGCCATCAGTAGCGGCGGACGATCCACAACCTAAAATCGTCGTCATAATGGCTGGAAATCACACGCCGACCTTCCTCGCTACTGCTACGCCTTCCGATTCTTCTAATTTCTCCCGATCGACAGAGCGGTTTTGA MRSLAASASAMKTGHYHFWNTSVPYLFGAITLTLLLILTALIFLVCSCRKHSSSSDEEDQKTKIDTPSVAADDPQPKIVVIMAGNHTPTFLATATPSDSSNFSRSTERF
BLAST of Cp4.1LG01g22170 vs. Swiss-Prot
Match: GDU6_ARATH (Protein GLUTAMINE DUMPER 6 OS=Arabidopsis thaliana GN=GDU6 PE=2 SV=1) HSP 1 Score: 57.4 bits (137), Expect = 1.1e-07 Identity = 39/85 (45.88%), Postives = 50/85 (58.82%), Query Frame = 1
BLAST of Cp4.1LG01g22170 vs. Swiss-Prot
Match: GDU5_ARATH (Protein GLUTAMINE DUMPER 5 OS=Arabidopsis thaliana GN=GDU5 PE=2 SV=2) HSP 1 Score: 57.0 bits (136), Expect = 1.5e-07 Identity = 34/75 (45.33%), Postives = 47/75 (62.67%), Query Frame = 1
BLAST of Cp4.1LG01g22170 vs. Swiss-Prot
Match: GDU2_ARATH (Protein GLUTAMINE DUMPER 2 OS=Arabidopsis thaliana GN=GDU2 PE=2 SV=1) HSP 1 Score: 52.8 bits (125), Expect = 2.8e-06 Identity = 36/88 (40.91%), Postives = 49/88 (55.68%), Query Frame = 1
BLAST of Cp4.1LG01g22170 vs. TrEMBL
Match: A0A061EGU8_THECC (Glutamine dumper 4, putative OS=Theobroma cacao GN=TCM_019104 PE=4 SV=1) HSP 1 Score: 73.9 bits (180), Expect = 1.3e-10 Identity = 39/89 (43.82%), Postives = 59/89 (66.29%), Query Frame = 1
BLAST of Cp4.1LG01g22170 vs. TrEMBL
Match: A0A059AE53_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_J01438 PE=4 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 3.8e-10 Identity = 38/76 (50.00%), Postives = 52/76 (68.42%), Query Frame = 1
BLAST of Cp4.1LG01g22170 vs. TrEMBL
Match: A0A059AF47_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_J01439 PE=4 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 8.5e-10 Identity = 49/104 (47.12%), Postives = 62/104 (59.62%), Query Frame = 1
BLAST of Cp4.1LG01g22170 vs. TrEMBL
Match: A0A0D2M132_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_001G205500 PE=4 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 8.5e-10 Identity = 41/96 (42.71%), Postives = 58/96 (60.42%), Query Frame = 1
BLAST of Cp4.1LG01g22170 vs. TrEMBL
Match: B9TNG5_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_1983860 PE=4 SV=1) HSP 1 Score: 70.9 bits (172), Expect = 1.1e-09 Identity = 39/90 (43.33%), Postives = 53/90 (58.89%), Query Frame = 1
BLAST of Cp4.1LG01g22170 vs. TAIR10
Match: AT3G30725.1 (AT3G30725.1 glutamine dumper 6) HSP 1 Score: 57.4 bits (137), Expect = 6.5e-09 Identity = 39/85 (45.88%), Postives = 50/85 (58.82%), Query Frame = 1
BLAST of Cp4.1LG01g22170 vs. TAIR10
Match: AT5G24920.1 (AT5G24920.1 glutamine dumper 5) HSP 1 Score: 57.0 bits (136), Expect = 8.4e-09 Identity = 34/75 (45.33%), Postives = 47/75 (62.67%), Query Frame = 1
BLAST of Cp4.1LG01g22170 vs. TAIR10
Match: AT4G25760.1 (AT4G25760.1 glutamine dumper 2) HSP 1 Score: 52.8 bits (125), Expect = 1.6e-07 Identity = 36/88 (40.91%), Postives = 49/88 (55.68%), Query Frame = 1
BLAST of Cp4.1LG01g22170 vs. TAIR10
Match: AT2G24762.1 (AT2G24762.1 glutamine dumper 4) HSP 1 Score: 50.4 bits (119), Expect = 7.9e-07 Identity = 32/83 (38.55%), Postives = 48/83 (57.83%), Query Frame = 1
BLAST of Cp4.1LG01g22170 vs. TAIR10
Match: AT4G31730.1 (AT4G31730.1 glutamine dumper 1) HSP 1 Score: 50.4 bits (119), Expect = 7.9e-07 Identity = 32/80 (40.00%), Postives = 44/80 (55.00%), Query Frame = 1
BLAST of Cp4.1LG01g22170 vs. NCBI nr
Match: gi|1009174700|ref|XP_015868479.1| (PREDICTED: protein GLUTAMINE DUMPER 2-like, partial [Ziziphus jujuba]) HSP 1 Score: 75.1 bits (183), Expect = 8.5e-11 Identity = 43/87 (49.43%), Postives = 51/87 (58.62%), Query Frame = 1
BLAST of Cp4.1LG01g22170 vs. NCBI nr
Match: gi|694396942|ref|XP_009373736.1| (PREDICTED: protein GLUTAMINE DUMPER 2-like [Pyrus x bretschneideri]) HSP 1 Score: 74.3 bits (181), Expect = 1.4e-10 Identity = 46/102 (45.10%), Postives = 60/102 (58.82%), Query Frame = 1
BLAST of Cp4.1LG01g22170 vs. NCBI nr
Match: gi|590651719|ref|XP_007032962.1| (Glutamine dumper 4, putative [Theobroma cacao]) HSP 1 Score: 73.9 bits (180), Expect = 1.9e-10 Identity = 39/89 (43.82%), Postives = 59/89 (66.29%), Query Frame = 1
BLAST of Cp4.1LG01g22170 vs. NCBI nr
Match: gi|694407094|ref|XP_009378310.1| (PREDICTED: protein GLUTAMINE DUMPER 1-like [Pyrus x bretschneideri]) HSP 1 Score: 73.9 bits (180), Expect = 1.9e-10 Identity = 41/95 (43.16%), Postives = 56/95 (58.95%), Query Frame = 1
BLAST of Cp4.1LG01g22170 vs. NCBI nr
Match: gi|698421614|ref|XP_009777637.1| (PREDICTED: protein GLUTAMINE DUMPER 6-like [Nicotiana sylvestris]) HSP 1 Score: 73.6 bits (179), Expect = 2.5e-10 Identity = 43/84 (51.19%), Postives = 56/84 (66.67%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|