MELO3C022064.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAATTCCGGCCACCAGCACCACCACCACCACTACCGCCTTTGGAATACTCCAATACCTTATCTCTTCGGCGGAATAGCCTTAACTCTACTTCTCATCCTCACCTCATTGATTTTATTTGCTTGTTCCTACCGGAAACGCCCTACTTCCTCTTCCTCTTTTTCCTACGACGAAGAACAACACCCGAAAATCATGAAGATCGATACGCCTTCCCCAACAACCCCCGCCGTCGTCATCATGGCTGGAAATCACACTCCCACCTTCCTCGCTACCGCTACTAATACACCACCCGCTTAA ATGAATTCCGGCCACCAGCACCACCACCACCACTACCGCCTTTGGAATACTCCAATACCTTATCTCTTCGGCGGAATAGCCTTAACTCTACTTCTCATCCTCACCTCATTGATTTTATTTGCTTGTTCCTACCGGAAACGCCCTACTTCCTCTTCCTCTTTTTCCTACGACGAAGAACAACACCCGAAAATCATGAAGATCGATACGCCTTCCCCAACAACCCCCGCCGTCGTCATCATGGCTGGAAATCACACTCCCACCTTCCTCGCTACCGCTACTAATACACCACCCGCTTAA ATGAATTCCGGCCACCAGCACCACCACCACCACTACCGCCTTTGGAATACTCCAATACCTTATCTCTTCGGCGGAATAGCCTTAACTCTACTTCTCATCCTCACCTCATTGATTTTATTTGCTTGTTCCTACCGGAAACGCCCTACTTCCTCTTCCTCTTTTTCCTACGACGAAGAACAACACCCGAAAATCATGAAGATCGATACGCCTTCCCCAACAACCCCCGCCGTCGTCATCATGGCTGGAAATCACACTCCCACCTTCCTCGCTACCGCTACTAATACACCACCCGCTTAA MNSGHQHHHHHYRLWNTPIPYLFGGIALTLLLILTSLILFACSYRKRPTSSSSFSYDEEQHPKIMKIDTPSPTTPAVVIMAGNHTPTFLATATNTPPA
BLAST of MELO3C022064.2 vs. NCBI nr
Match: KHN13786.1 (hypothetical protein glysoja_016070 [Glycine soja]) HSP 1 Score: 72.0 bits (175), Expect = 1.3e-09 Identity = 37/78 (47.44%), Postives = 53/78 (67.95%), Query Frame = 0
BLAST of MELO3C022064.2 vs. NCBI nr
Match: PSR87782.1 (Protein GLUTAMINE DUMPER like [Actinidia chinensis var. chinensis]) HSP 1 Score: 70.1 bits (170), Expect = 4.8e-09 Identity = 38/82 (46.34%), Postives = 56/82 (68.29%), Query Frame = 0
BLAST of MELO3C022064.2 vs. NCBI nr
Match: XP_022949049.1 (protein GLUTAMINE DUMPER 6-like [Cucurbita moschata]) HSP 1 Score: 69.7 bits (169), Expect = 6.2e-09 Identity = 39/79 (49.37%), Postives = 51/79 (64.56%), Query Frame = 0
BLAST of MELO3C022064.2 vs. NCBI nr
Match: XP_012088114.1 (protein GLUTAMINE DUMPER 3 [Jatropha curcas] >KDP24335.1 hypothetical protein JCGZ_25631 [Jatropha curcas]) HSP 1 Score: 68.6 bits (166), Expect = 1.4e-08 Identity = 36/76 (47.37%), Postives = 51/76 (67.11%), Query Frame = 0
BLAST of MELO3C022064.2 vs. NCBI nr
Match: XP_023524592.1 (protein GLUTAMINE DUMPER 6-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 68.2 bits (165), Expect = 1.8e-08 Identity = 39/78 (50.00%), Postives = 50/78 (64.10%), Query Frame = 0
BLAST of MELO3C022064.2 vs. TAIR10
Match: AT5G24920.1 (glutamine dumper 5) HSP 1 Score: 55.1 bits (131), Expect = 2.9e-08 Identity = 33/77 (42.86%), Postives = 45/77 (58.44%), Query Frame = 0
BLAST of MELO3C022064.2 vs. TAIR10
Match: AT2G24762.1 (glutamine dumper 4) HSP 1 Score: 53.9 bits (128), Expect = 6.4e-08 Identity = 34/80 (42.50%), Postives = 49/80 (61.25%), Query Frame = 0
BLAST of MELO3C022064.2 vs. TAIR10
Match: AT4G25760.1 (glutamine dumper 2) HSP 1 Score: 49.7 bits (117), Expect = 1.2e-06 Identity = 31/80 (38.75%), Postives = 45/80 (56.25%), Query Frame = 0
BLAST of MELO3C022064.2 vs. TAIR10
Match: AT5G57685.1 (glutamine dumper 3) HSP 1 Score: 48.9 bits (115), Expect = 2.1e-06 Identity = 32/87 (36.78%), Postives = 47/87 (54.02%), Query Frame = 0
BLAST of MELO3C022064.2 vs. TAIR10
Match: AT4G31730.1 (glutamine dumper 1) HSP 1 Score: 47.0 bits (110), Expect = 7.8e-06 Identity = 31/80 (38.75%), Postives = 46/80 (57.50%), Query Frame = 0
BLAST of MELO3C022064.2 vs. Swiss-Prot
Match: sp|Q3E965|GDU5_ARATH (Protein GLUTAMINE DUMPER 5 OS=Arabidopsis thaliana OX=3702 GN=GDU5 PE=2 SV=2) HSP 1 Score: 55.1 bits (131), Expect = 5.2e-07 Identity = 33/77 (42.86%), Postives = 45/77 (58.44%), Query Frame = 0
BLAST of MELO3C022064.2 vs. Swiss-Prot
Match: sp|Q8S8A0|GDU4_ARATH (Protein GLUTAMINE DUMPER 4 OS=Arabidopsis thaliana OX=3702 GN=GDU4 PE=2 SV=1) HSP 1 Score: 53.9 bits (128), Expect = 1.2e-06 Identity = 34/80 (42.50%), Postives = 49/80 (61.25%), Query Frame = 0
BLAST of MELO3C022064.2 vs. Swiss-Prot
Match: sp|Q9SW07|GDU2_ARATH (Protein GLUTAMINE DUMPER 2 OS=Arabidopsis thaliana OX=3702 GN=GDU2 PE=2 SV=1) HSP 1 Score: 49.7 bits (117), Expect = 2.2e-05 Identity = 31/80 (38.75%), Postives = 45/80 (56.25%), Query Frame = 0
BLAST of MELO3C022064.2 vs. Swiss-Prot
Match: sp|Q9FHH5|GDU3_ARATH (Protein GLUTAMINE DUMPER 3 OS=Arabidopsis thaliana OX=3702 GN=GDU3 PE=2 SV=1) HSP 1 Score: 48.9 bits (115), Expect = 3.7e-05 Identity = 32/87 (36.78%), Postives = 47/87 (54.02%), Query Frame = 0
BLAST of MELO3C022064.2 vs. Swiss-Prot
Match: sp|O81775|GDU1_ARATH (Protein GLUTAMINE DUMPER 1 OS=Arabidopsis thaliana OX=3702 GN=GDU1 PE=1 SV=1) HSP 1 Score: 47.0 bits (110), Expect = 1.4e-04 Identity = 31/80 (38.75%), Postives = 46/80 (57.50%), Query Frame = 0
BLAST of MELO3C022064.2 vs. TrEMBL
Match: tr|A0A2R6P9V1|A0A2R6P9V1_ACTCH (Protein GLUTAMINE DUMPER like OS=Actinidia chinensis var. chinensis OX=1590841 GN=CEY00_Acc30812 PE=4 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 3.2e-09 Identity = 38/82 (46.34%), Postives = 56/82 (68.29%), Query Frame = 0
BLAST of MELO3C022064.2 vs. TrEMBL
Match: tr|A0A2N9GMR8|A0A2N9GMR8_FAGSY (Uncharacterized protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS28747 PE=4 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 4.1e-09 Identity = 38/79 (48.10%), Postives = 53/79 (67.09%), Query Frame = 0
BLAST of MELO3C022064.2 vs. TrEMBL
Match: tr|A0A2N9GMM3|A0A2N9GMM3_FAGSY (Uncharacterized protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS28744 PE=4 SV=1) HSP 1 Score: 68.9 bits (167), Expect = 7.0e-09 Identity = 40/78 (51.28%), Postives = 51/78 (65.38%), Query Frame = 0
BLAST of MELO3C022064.2 vs. TrEMBL
Match: tr|A0A067JWF6|A0A067JWF6_JATCU (Uncharacterized protein OS=Jatropha curcas OX=180498 GN=JCGZ_25631 PE=4 SV=1) HSP 1 Score: 68.6 bits (166), Expect = 9.2e-09 Identity = 36/76 (47.37%), Postives = 51/76 (67.11%), Query Frame = 0
BLAST of MELO3C022064.2 vs. TrEMBL
Match: tr|A0A2I4EBB2|A0A2I4EBB2_9ROSI (protein GLUTAMINE DUMPER 4-like OS=Juglans regia OX=51240 GN=LOC108988046 PE=4 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 2.7e-08 Identity = 40/78 (51.28%), Postives = 51/78 (65.38%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|