Cla016489 (gene) Watermelon (97103) v1
The following sequences are available for this feature:
Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAATTCCGGCCACCACCACCACCACCTCTGGAATACTCCGATACCGTATCTCTTCGGCGGAATAGCATTAACTCTGCTTCTCATCCTCACCGCATTGATTTTACTCGCTTGTTCTTACCGGAAACGGTCTTCCGACGAAGAACACCAGAAGATGAAGATCGATACGCCTGCAGCAAAAACGGCCGCCGTCATCATGGCCGGAAATCACACTCCGACGTTCCTGGCTACCGTTACTATGGCCGCTTAA ATGAATTCCGGCCACCACCACCACCACCTCTGGAATACTCCGATACCGTATCTCTTCGGCGGAATAGCATTAACTCTGCTTCTCATCCTCACCGCATTGATTTTACTCGCTTGTTCTTACCGGAAACGGTCTTCCGACGAAGAACACCAGAAGATGAAGATCGATACGCCTGCAGCAAAAACGGCCGCCGTCATCATGGCCGGAAATCACACTCCGACGTTCCTGGCTACCGTTACTATGGCCGCTTAA ATGAATTCCGGCCACCACCACCACCACCTCTGGAATACTCCGATACCGTATCTCTTCGGCGGAATAGCATTAACTCTGCTTCTCATCCTCACCGCATTGATTTTACTCGCTTGTTCTTACCGGAAACGGTCTTCCGACGAAGAACACCAGAAGATGAAGATCGATACGCCTGCAGCAAAAACGGCCGCCGTCATCATGGCCGGAAATCACACTCCGACGTTCCTGGCTACCGTTACTATGGCCGCTTAA MNSGHHHHHLWNTPIPYLFGGIALTLLLILTALILLACSYRKRSSDEEHQKMKIDTPAAKTAAVIMAGNHTPTFLATVTMAA
BLAST of Cla016489 vs. Swiss-Prot
Match: GDU5_ARATH (Protein GLUTAMINE DUMPER 5 OS=Arabidopsis thaliana GN=GDU5 PE=2 SV=2) HSP 1 Score: 67.0 bits (162), Expect = 1.1e-10 Identity = 39/78 (50.00%), Postives = 46/78 (58.97%), Query Frame = 1
BLAST of Cla016489 vs. Swiss-Prot
Match: GDU3_ARATH (Protein GLUTAMINE DUMPER 3 OS=Arabidopsis thaliana GN=GDU3 PE=2 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 2.1e-09 Identity = 39/88 (44.32%), Postives = 46/88 (52.27%), Query Frame = 1
BLAST of Cla016489 vs. Swiss-Prot
Match: GDU2_ARATH (Protein GLUTAMINE DUMPER 2 OS=Arabidopsis thaliana GN=GDU2 PE=2 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 7.8e-09 Identity = 36/83 (43.37%), Postives = 43/83 (51.81%), Query Frame = 1
BLAST of Cla016489 vs. Swiss-Prot
Match: GDU1_ARATH (Protein GLUTAMINE DUMPER 1 OS=Arabidopsis thaliana GN=GDU1 PE=1 SV=1) HSP 1 Score: 58.9 bits (141), Expect = 3.0e-08 Identity = 36/83 (43.37%), Postives = 43/83 (51.81%), Query Frame = 1
BLAST of Cla016489 vs. Swiss-Prot
Match: GDU4_ARATH (Protein GLUTAMINE DUMPER 4 OS=Arabidopsis thaliana GN=GDU4 PE=2 SV=1) HSP 1 Score: 58.5 bits (140), Expect = 3.9e-08 Identity = 34/80 (42.50%), Postives = 45/80 (56.25%), Query Frame = 1
BLAST of Cla016489 vs. TrEMBL
Match: A0A0A0KW00_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G119770 PE=4 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 4.4e-11 Identity = 41/78 (52.56%), Postives = 51/78 (65.38%), Query Frame = 1
BLAST of Cla016489 vs. TrEMBL
Match: M5WW82_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa025614mg PE=4 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 7.6e-11 Identity = 38/77 (49.35%), Postives = 48/77 (62.34%), Query Frame = 1
BLAST of Cla016489 vs. TrEMBL
Match: A0A059AE53_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_J01438 PE=4 SV=1) HSP 1 Score: 73.9 bits (180), Expect = 9.9e-11 Identity = 39/75 (52.00%), Postives = 52/75 (69.33%), Query Frame = 1
BLAST of Cla016489 vs. TrEMBL
Match: A0A0B2Q391_GLYSO (Uncharacterized protein OS=Glycine soja GN=glysoja_029720 PE=4 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 1.7e-10 Identity = 36/82 (43.90%), Postives = 48/82 (58.54%), Query Frame = 1
BLAST of Cla016489 vs. TrEMBL
Match: C6THG3_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_08G254800 PE=2 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 1.7e-10 Identity = 36/82 (43.90%), Postives = 48/82 (58.54%), Query Frame = 1
BLAST of Cla016489 vs. NCBI nr
Match: gi|694396942|ref|XP_009373736.1| (PREDICTED: protein GLUTAMINE DUMPER 2-like [Pyrus x bretschneideri]) HSP 1 Score: 80.1 bits (196), Expect = 2.0e-12 Identity = 41/75 (54.67%), Postives = 50/75 (66.67%), Query Frame = 1
BLAST of Cla016489 vs. NCBI nr
Match: gi|658035951|ref|XP_008353514.1| (PREDICTED: protein GLUTAMINE DUMPER 2-like [Malus domestica]) HSP 1 Score: 77.0 bits (188), Expect = 1.7e-11 Identity = 41/77 (53.25%), Postives = 51/77 (66.23%), Query Frame = 1
BLAST of Cla016489 vs. NCBI nr
Match: gi|700198590|gb|KGN53748.1| (hypothetical protein Csa_4G119770 [Cucumis sativus]) HSP 1 Score: 75.1 bits (183), Expect = 6.4e-11 Identity = 41/78 (52.56%), Postives = 51/78 (65.38%), Query Frame = 1
BLAST of Cla016489 vs. NCBI nr
Match: gi|595957710|ref|XP_007216730.1| (hypothetical protein PRUPE_ppa025614mg [Prunus persica]) HSP 1 Score: 74.3 bits (181), Expect = 1.1e-10 Identity = 38/77 (49.35%), Postives = 48/77 (62.34%), Query Frame = 1
BLAST of Cla016489 vs. NCBI nr
Match: gi|702486054|ref|XP_010034416.1| (PREDICTED: protein GLUTAMINE DUMPER 6-like [Eucalyptus grandis]) HSP 1 Score: 73.9 bits (180), Expect = 1.4e-10 Identity = 39/75 (52.00%), Postives = 52/75 (69.33%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|