Cp4.1LG01g05690 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.TGCAAGCTCCTAAGAAGAAGATGTGGTCAACAATGTCCCTTCGCCCCATACTTCTCCCCCCACGAGCCTCACAAGTTCGCCTCGGTCCACAAGGTCTTCGGCGCCAGCAATGTCTCCAAGATGCTCAAGGTAACGGTAACGATAAGAATTTATTGATATAAAATTGAAAGTTTAAAGGCCGTGATAGAATATTTTTTTTTTACAGGAAGTTCCGAAAAATGAAAGAGATAATACTGCGAATAGTCTAATTTATGAAGCTAATGTGAGGCTGAGAGATCCTGTGTATGGCTGCATGGGCGCCATTTCATGTCTACAACACCAAGTCCAAGCGTTACAAGCTACACTCACTGCAGTTAGAGCTGAGATACTGAGATGCAAATATAGACAAGGTAATATGGTTTCCATTGCCCTACCACCACCGCCACCGCCGCCTCCCGAGCTACCTCCGCCGCCTCTTCAGGATGCTTCTTCCTCTTCCTCCACCTTGTACAACCGGCCCACGGTGGCCGCTGATTCATCCTTTTTCGCATTTTAG TGCAAGCTCCTAAGAAGAAGATGTGGTCAACAATGTCCCTTCGCCCCATACTTCTCCCCCCACGAGCCTCACAAGTTCGCCTCGGTCCACAAGGTCTTCGGCGCCAGCAATGTCTCCAAGATGCTCAAGGAAGTTCCGAAAAATGAAAGAGATAATACTGCGAATAGTCTAATTTATGAAGCTAATGTGAGGCTGAGAGATCCTGTGTATGGCTGCATGGGCGCCATTTCATGTCTACAACACCAAGTCCAAGCGTTACAAGCTACACTCACTGCAGTTAGAGCTGAGATACTGAGATGCAAATATAGACAAGGTAATATGGTTTCCATTGCCCTACCACCACCGCCACCGCCGCCTCCCGAGCTACCTCCGCCGCCTCTTCAGGATGCTTCTTCCTCTTCCTCCACCTTGTACAACCGGCCCACGGTGGCCGCTGATTCATCCTTTTTCGCATTTTAG TGCAAGCTCCTAAGAAGAAGATGTGGTCAACAATGTCCCTTCGCCCCATACTTCTCCCCCCACGAGCCTCACAAGTTCGCCTCGGTCCACAAGGTCTTCGGCGCCAGCAATGTCTCCAAGATGCTCAAGGAAGTTCCGAAAAATGAAAGAGATAATACTGCGAATAGTCTAATTTATGAAGCTAATGTGAGGCTGAGAGATCCTGTGTATGGCTGCATGGGCGCCATTTCATGTCTACAACACCAAGTCCAAGCGTTACAAGCTACACTCACTGCAGTTAGAGCTGAGATACTGAGATGCAAATATAGACAAGGTAATATGGTTTCCATTGCCCTACCACCACCGCCACCGCCGCCTCCCGAGCTACCTCCGCCGCCTCTTCAGGATGCTTCTTCCTCTTCCTCCACCTTGTACAACCGGCCCACGGTGGCCGCTGATTCATCCTTTTTCGCATTTTAG CKLLRRRCGQQCPFAPYFSPHEPHKFASVHKVFGASNVSKMLKEVPKNERDNTANSLIYEANVRLRDPVYGCMGAISCLQHQVQALQATLTAVRAEILRCKYRQGNMVSIALPPPPPPPPELPPPPLQDASSSSSTLYNRPTVAADSSFFAF
BLAST of Cp4.1LG01g05690 vs. Swiss-Prot
Match: LBD15_ARATH (LOB domain-containing protein 15 OS=Arabidopsis thaliana GN=LBD15 PE=2 SV=2) HSP 1 Score: 178.7 bits (452), Expect = 4.8e-44 Identity = 99/161 (61.49%), Postives = 116/161 (72.05%), Query Frame = 1
BLAST of Cp4.1LG01g05690 vs. Swiss-Prot
Match: LBD13_ARATH (LOB domain-containing protein 13 OS=Arabidopsis thaliana GN=LBD13 PE=2 SV=2) HSP 1 Score: 172.9 bits (437), Expect = 2.6e-42 Identity = 77/109 (70.64%), Postives = 95/109 (87.16%), Query Frame = 1
BLAST of Cp4.1LG01g05690 vs. Swiss-Prot
Match: LBD12_ARATH (LOB domain-containing protein 12 OS=Arabidopsis thaliana GN=LBD12 PE=2 SV=2) HSP 1 Score: 141.0 bits (354), Expect = 1.1e-32 Identity = 66/98 (67.35%), Postives = 79/98 (80.61%), Query Frame = 1
BLAST of Cp4.1LG01g05690 vs. Swiss-Prot
Match: LBD4_ARATH (LOB domain-containing protein 4 OS=Arabidopsis thaliana GN=LBD4 PE=2 SV=1) HSP 1 Score: 136.7 bits (343), Expect = 2.1e-31 Identity = 66/118 (55.93%), Postives = 85/118 (72.03%), Query Frame = 1
BLAST of Cp4.1LG01g05690 vs. Swiss-Prot
Match: LOB_ARATH (Protein LATERAL ORGAN BOUNDARIES OS=Arabidopsis thaliana GN=LOB PE=2 SV=1) HSP 1 Score: 132.5 bits (332), Expect = 3.9e-30 Identity = 72/148 (48.65%), Postives = 92/148 (62.16%), Query Frame = 1
BLAST of Cp4.1LG01g05690 vs. TrEMBL
Match: A0A0A0KM94_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G219380 PE=4 SV=1) HSP 1 Score: 220.7 bits (561), Expect = 1.2e-54 Identity = 117/170 (68.82%), Postives = 131/170 (77.06%), Query Frame = 1
BLAST of Cp4.1LG01g05690 vs. TrEMBL
Match: A0A0B0NU48_GOSAR (LOB domain-containing 15-like protein OS=Gossypium arboreum GN=F383_01332 PE=4 SV=1) HSP 1 Score: 209.9 bits (533), Expect = 2.1e-51 Identity = 104/157 (66.24%), Postives = 126/157 (80.25%), Query Frame = 1
BLAST of Cp4.1LG01g05690 vs. TrEMBL
Match: A0A0D2RW35_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_012G015900 PE=4 SV=1) HSP 1 Score: 206.1 bits (523), Expect = 3.1e-50 Identity = 106/159 (66.67%), Postives = 124/159 (77.99%), Query Frame = 1
BLAST of Cp4.1LG01g05690 vs. TrEMBL
Match: B9S4B8_RICCO (LOB domain-containing protein, putative OS=Ricinus communis GN=RCOM_0689060 PE=4 SV=1) HSP 1 Score: 203.4 bits (516), Expect = 2.0e-49 Identity = 108/167 (64.67%), Postives = 123/167 (73.65%), Query Frame = 1
BLAST of Cp4.1LG01g05690 vs. TrEMBL
Match: D7T4G0_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_13s0067g02380 PE=4 SV=1) HSP 1 Score: 202.6 bits (514), Expect = 3.4e-49 Identity = 108/168 (64.29%), Postives = 126/168 (75.00%), Query Frame = 1
BLAST of Cp4.1LG01g05690 vs. TAIR10
Match: AT2G40470.1 (AT2G40470.1 LOB domain-containing protein 15) HSP 1 Score: 178.7 bits (452), Expect = 2.7e-45 Identity = 99/161 (61.49%), Postives = 116/161 (72.05%), Query Frame = 1
BLAST of Cp4.1LG01g05690 vs. TAIR10
Match: AT2G30340.1 (AT2G30340.1 LOB domain-containing protein 13) HSP 1 Score: 172.9 bits (437), Expect = 1.5e-43 Identity = 77/109 (70.64%), Postives = 95/109 (87.16%), Query Frame = 1
BLAST of Cp4.1LG01g05690 vs. TAIR10
Match: AT2G30130.1 (AT2G30130.1 Lateral organ boundaries (LOB) domain family protein) HSP 1 Score: 141.0 bits (354), Expect = 6.2e-34 Identity = 66/98 (67.35%), Postives = 79/98 (80.61%), Query Frame = 1
BLAST of Cp4.1LG01g05690 vs. TAIR10
Match: AT1G31320.1 (AT1G31320.1 LOB domain-containing protein 4) HSP 1 Score: 136.7 bits (343), Expect = 1.2e-32 Identity = 66/118 (55.93%), Postives = 85/118 (72.03%), Query Frame = 1
BLAST of Cp4.1LG01g05690 vs. TAIR10
Match: AT5G63090.2 (AT5G63090.2 Lateral organ boundaries (LOB) domain family protein) HSP 1 Score: 132.5 bits (332), Expect = 2.2e-31 Identity = 72/148 (48.65%), Postives = 92/148 (62.16%), Query Frame = 1
BLAST of Cp4.1LG01g05690 vs. NCBI nr
Match: gi|449457480|ref|XP_004146476.1| (PREDICTED: LOB domain-containing protein 15 [Cucumis sativus]) HSP 1 Score: 220.7 bits (561), Expect = 1.7e-54 Identity = 117/170 (68.82%), Postives = 131/170 (77.06%), Query Frame = 1
BLAST of Cp4.1LG01g05690 vs. NCBI nr
Match: gi|659114146|ref|XP_008456927.1| (PREDICTED: LOB domain-containing protein 15 [Cucumis melo]) HSP 1 Score: 219.9 bits (559), Expect = 3.0e-54 Identity = 116/171 (67.84%), Postives = 131/171 (76.61%), Query Frame = 1
BLAST of Cp4.1LG01g05690 vs. NCBI nr
Match: gi|728838615|gb|KHG18058.1| (LOB domain-containing 15 -like protein [Gossypium arboreum]) HSP 1 Score: 209.9 bits (533), Expect = 3.1e-51 Identity = 104/157 (66.24%), Postives = 126/157 (80.25%), Query Frame = 1
BLAST of Cp4.1LG01g05690 vs. NCBI nr
Match: gi|823250725|ref|XP_012457948.1| (PREDICTED: LOB domain-containing protein 15-like [Gossypium raimondii]) HSP 1 Score: 206.1 bits (523), Expect = 4.4e-50 Identity = 106/159 (66.67%), Postives = 124/159 (77.99%), Query Frame = 1
BLAST of Cp4.1LG01g05690 vs. NCBI nr
Match: gi|255559635|ref|XP_002520837.1| (PREDICTED: LOB domain-containing protein 15 [Ricinus communis]) HSP 1 Score: 203.4 bits (516), Expect = 2.9e-49 Identity = 108/167 (64.67%), Postives = 123/167 (73.65%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|