Cp4.1LG01g03430 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCACCGATCGGTGAGCTGGAACCGATTCTCCGATGAATACTACTCGTCCTCCTCTCCGTCGCCGGCGCTGTCATCGACGCCAGGCCAGGCGTTGCGATTATCATTTGACGGAAATGAGCAGCCGACGAGTTATCCAGCGGATGAGATGGTGAAGCGAGAGAAGGCGCGATTCAAGTTCGCCGCAACTGCTGTTCATGTGATTCCTCTCGTTTTGGTGCTCTGCGCCATTCTTCTGTGGTTCTTCTCCAATCCAGGTAAGAGAAGATCGTAA ATGCACCGATCGGTGAGCTGGAACCGATTCTCCGATGAATACTACTCGTCCTCCTCTCCGTCGCCGGCGCTGTCATCGACGCCAGGCCAGGCGTTGCGATTATCATTTGACGGAAATGAGCAGCCGACGAGTTATCCAGCGGATGAGATGGTGAAGCGAGAGAAGGCGCGATTCAAGTTCGCCGCAACTGCTGTTCATGTGATTCCTCTCGTTTTGGTGCTCTGCGCCATTCTTCTGTGGTTCTTCTCCAATCCAGGTAAGAGAAGATCGTAA ATGCACCGATCGGTGAGCTGGAACCGATTCTCCGATGAATACTACTCGTCCTCCTCTCCGTCGCCGGCGCTGTCATCGACGCCAGGCCAGGCGTTGCGATTATCATTTGACGGAAATGAGCAGCCGACGAGTTATCCAGCGGATGAGATGGTGAAGCGAGAGAAGGCGCGATTCAAGTTCGCCGCAACTGCTGTTCATGTGATTCCTCTCGTTTTGGTGCTCTGCGCCATTCTTCTGTGGTTCTTCTCCAATCCAGGTAAGAGAAGATCGTAA MHRSVSWNRFSDEYYSSSSPSPALSSTPGQALRLSFDGNEQPTSYPADEMVKREKARFKFAATAVHVIPLVLVLCAILLWFFSNPGKRRS
BLAST of Cp4.1LG01g03430 vs. TrEMBL
Match: A0A0A0KZ80_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G025085 PE=4 SV=1) HSP 1 Score: 117.1 bits (292), Expect = 1.1e-23 Identity = 64/89 (71.91%), Postives = 71/89 (79.78%), Query Frame = 1
BLAST of Cp4.1LG01g03430 vs. TrEMBL
Match: A0A0B2RE95_GLYSO (Uncharacterized protein OS=Glycine soja GN=glysoja_034027 PE=4 SV=1) HSP 1 Score: 97.8 bits (242), Expect = 7.0e-18 Identity = 51/88 (57.95%), Postives = 60/88 (68.18%), Query Frame = 1
BLAST of Cp4.1LG01g03430 vs. TrEMBL
Match: I1LCI6_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_10G193700 PE=4 SV=2) HSP 1 Score: 97.8 bits (242), Expect = 7.0e-18 Identity = 51/88 (57.95%), Postives = 60/88 (68.18%), Query Frame = 1
BLAST of Cp4.1LG01g03430 vs. TrEMBL
Match: A0A0B2NV23_GLYSO (Uncharacterized protein OS=Glycine soja GN=glysoja_000659 PE=4 SV=1) HSP 1 Score: 97.4 bits (241), Expect = 9.2e-18 Identity = 51/88 (57.95%), Postives = 60/88 (68.18%), Query Frame = 1
BLAST of Cp4.1LG01g03430 vs. TrEMBL
Match: I1NHW0_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_20G196700 PE=4 SV=2) HSP 1 Score: 97.4 bits (241), Expect = 9.2e-18 Identity = 51/88 (57.95%), Postives = 60/88 (68.18%), Query Frame = 1
BLAST of Cp4.1LG01g03430 vs. TAIR10
Match: AT5G61630.1 (AT5G61630.1 unknown protein) HSP 1 Score: 75.1 bits (183), Expect = 2.5e-14 Identity = 40/86 (46.51%), Postives = 55/86 (63.95%), Query Frame = 1
BLAST of Cp4.1LG01g03430 vs. TAIR10
Match: AT5G07490.1 (AT5G07490.1 unknown protein) HSP 1 Score: 71.2 bits (173), Expect = 3.6e-13 Identity = 39/89 (43.82%), Postives = 53/89 (59.55%), Query Frame = 1
BLAST of Cp4.1LG01g03430 vs. TAIR10
Match: AT2G35658.2 (AT2G35658.2 unknown protein) HSP 1 Score: 62.4 bits (150), Expect = 1.7e-10 Identity = 37/92 (40.22%), Postives = 55/92 (59.78%), Query Frame = 1
BLAST of Cp4.1LG01g03430 vs. TAIR10
Match: AT4G16840.1 (AT4G16840.1 unknown protein) HSP 1 Score: 50.8 bits (120), Expect = 5.0e-07 Identity = 32/92 (34.78%), Postives = 47/92 (51.09%), Query Frame = 1
BLAST of Cp4.1LG01g03430 vs. NCBI nr
Match: gi|778690315|ref|XP_011653100.1| (PREDICTED: uncharacterized protein LOC105435175 [Cucumis sativus]) HSP 1 Score: 117.1 bits (292), Expect = 1.6e-23 Identity = 64/89 (71.91%), Postives = 71/89 (79.78%), Query Frame = 1
BLAST of Cp4.1LG01g03430 vs. NCBI nr
Match: gi|659107769|ref|XP_008453849.1| (PREDICTED: uncharacterized protein LOC103494452 [Cucumis melo]) HSP 1 Score: 109.4 bits (272), Expect = 3.3e-21 Identity = 60/89 (67.42%), Postives = 67/89 (75.28%), Query Frame = 1
BLAST of Cp4.1LG01g03430 vs. NCBI nr
Match: gi|356533848|ref|XP_003535470.1| (PREDICTED: uncharacterized protein LOC100813926 [Glycine max]) HSP 1 Score: 97.8 bits (242), Expect = 1.0e-17 Identity = 51/88 (57.95%), Postives = 60/88 (68.18%), Query Frame = 1
BLAST of Cp4.1LG01g03430 vs. NCBI nr
Match: gi|356574708|ref|XP_003555487.1| (PREDICTED: uncharacterized protein LOC100805238 [Glycine max]) HSP 1 Score: 97.4 bits (241), Expect = 1.3e-17 Identity = 51/88 (57.95%), Postives = 60/88 (68.18%), Query Frame = 1
BLAST of Cp4.1LG01g03430 vs. NCBI nr
Match: gi|1012349525|gb|KYP60715.1| (hypothetical protein KK1_023127 [Cajanus cajan]) HSP 1 Score: 95.5 bits (236), Expect = 5.0e-17 Identity = 48/86 (55.81%), Postives = 60/86 (69.77%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|