Cla015869 (gene) Watermelon (97103) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGATTCCGTTTAAACAGCCCAAGGAAATCATCATCGACTGTACCAAAGGGGTTTTTCGCCGTCTACGTTGGAGAGACACAAAAGAGACGACATGTGATTCCGATTTCTTACTTGAAGCATCCATCGTTTCAAGATTTGTTGAGTAAAGCTGAAGAAGAGTTTGGATTCGATCATCCAATGGGGGGCTTAACGATCCCTTGCAATGAAGATGTGTTCTTCGAAGTCACTTCTCGCTTGGCTAATTGTTGA ATGGGATTCCGTTTAAACAGCCCAAGGAAATCATCATCGACTGTACCAAAGGGGTTTTTCGCCGTCTACGTTGGAGAGACACAAAAGAGACGACATGTGATTCCGATTTCTTACTTGAAGCATCCATCGTTTCAAGATTTGTTGAGTAAAGCTGAAGAAGAGTTTGGATTCGATCATCCAATGGGGGGCTTAACGATCCCTTGCAATGAAGATGTGTTCTTCGAAGTCACTTCTCGCTTGGCTAATTGTTGA ATGGGATTCCGTTTAAACAGCCCAAGGAAATCATCATCGACTGTACCAAAGGGGTTTTTCGCCGTCTACGTTGGAGAGACACAAAAGAGACGACATGTGATTCCGATTTCTTACTTGAAGCATCCATCGTTTCAAGATTTGTTGAGTAAAGCTGAAGAAGAGTTTGGATTCGATCATCCAATGGGGGGCTTAACGATCCCTTGCAATGAAGATGTGTTCTTCGAAGTCACTTCTCGCTTGGCTAATTGTTGA MGFRLNSPRKSSSTVPKGFFAVYVGETQKRRHVIPISYLKHPSFQDLLSKAEEEFGFDHPMGGLTIPCNEDVFFEVTSRLANC
BLAST of Cla015869 vs. Swiss-Prot
Match: SAU21_ARATH (Auxin-responsive protein SAUR21 OS=Arabidopsis thaliana GN=SAUR21 PE=2 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 2.7e-25 Identity = 52/72 (72.22%), Postives = 59/72 (81.94%), Query Frame = 1
BLAST of Cla015869 vs. Swiss-Prot
Match: SAU24_ARATH (Auxin-responsive protein SAUR24 OS=Arabidopsis thaliana GN=SAUR24 PE=2 SV=1) HSP 1 Score: 113.6 bits (283), Expect = 1.0e-24 Identity = 51/70 (72.86%), Postives = 57/70 (81.43%), Query Frame = 1
BLAST of Cla015869 vs. Swiss-Prot
Match: SAU20_ARATH (Auxin-responsive protein SAUR20 OS=Arabidopsis thaliana GN=SAUR20 PE=2 SV=1) HSP 1 Score: 113.2 bits (282), Expect = 1.3e-24 Identity = 52/75 (69.33%), Postives = 59/75 (78.67%), Query Frame = 1
BLAST of Cla015869 vs. Swiss-Prot
Match: SAU22_ARATH (Auxin-responsive protein SAUR22 OS=Arabidopsis thaliana GN=SAUR22 PE=2 SV=1) HSP 1 Score: 112.8 bits (281), Expect = 1.7e-24 Identity = 50/68 (73.53%), Postives = 57/68 (83.82%), Query Frame = 1
BLAST of Cla015869 vs. Swiss-Prot
Match: SAU23_ARATH (Auxin-responsive protein SAUR23 OS=Arabidopsis thaliana GN=SAUR23 PE=2 SV=1) HSP 1 Score: 112.1 bits (279), Expect = 3.0e-24 Identity = 51/68 (75.00%), Postives = 56/68 (82.35%), Query Frame = 1
BLAST of Cla015869 vs. TrEMBL
Match: A0A0A0K4I7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G008440 PE=4 SV=1) HSP 1 Score: 167.2 bits (422), Expect = 8.7e-39 Identity = 81/84 (96.43%), Postives = 82/84 (97.62%), Query Frame = 1
BLAST of Cla015869 vs. TrEMBL
Match: K4B3U6_SOLLC (Uncharacterized protein OS=Solanum lycopersicum PE=4 SV=1) HSP 1 Score: 122.1 bits (305), Expect = 3.2e-25 Identity = 56/75 (74.67%), Postives = 61/75 (81.33%), Query Frame = 1
BLAST of Cla015869 vs. TrEMBL
Match: A0A067K719_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_19614 PE=4 SV=1) HSP 1 Score: 120.9 bits (302), Expect = 7.1e-25 Identity = 54/70 (77.14%), Postives = 62/70 (88.57%), Query Frame = 1
BLAST of Cla015869 vs. TrEMBL
Match: A0A067JXR9_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_19618 PE=4 SV=1) HSP 1 Score: 120.2 bits (300), Expect = 1.2e-24 Identity = 54/76 (71.05%), Postives = 63/76 (82.89%), Query Frame = 1
BLAST of Cla015869 vs. TrEMBL
Match: M4CD46_BRARP (Uncharacterized protein OS=Brassica rapa subsp. pekinensis PE=4 SV=1) HSP 1 Score: 119.8 bits (299), Expect = 1.6e-24 Identity = 53/75 (70.67%), Postives = 66/75 (88.00%), Query Frame = 1
BLAST of Cla015869 vs. NCBI nr
Match: gi|778722813|ref|XP_011658572.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]) HSP 1 Score: 167.2 bits (422), Expect = 1.2e-38 Identity = 81/84 (96.43%), Postives = 82/84 (97.62%), Query Frame = 1
BLAST of Cla015869 vs. NCBI nr
Match: gi|659094348|ref|XP_008448012.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis melo]) HSP 1 Score: 163.3 bits (412), Expect = 1.8e-37 Identity = 79/84 (94.05%), Postives = 81/84 (96.43%), Query Frame = 1
BLAST of Cla015869 vs. NCBI nr
Match: gi|460370289|ref|XP_004230986.1| (PREDICTED: auxin-induced protein 15A-like [Solanum lycopersicum]) HSP 1 Score: 122.1 bits (305), Expect = 4.6e-25 Identity = 56/75 (74.67%), Postives = 61/75 (81.33%), Query Frame = 1
BLAST of Cla015869 vs. NCBI nr
Match: gi|802707914|ref|XP_012084407.1| (PREDICTED: auxin-induced protein 15A-like [Jatropha curcas]) HSP 1 Score: 120.9 bits (302), Expect = 1.0e-24 Identity = 54/70 (77.14%), Postives = 62/70 (88.57%), Query Frame = 1
BLAST of Cla015869 vs. NCBI nr
Match: gi|923757014|ref|XP_013676066.1| (PREDICTED: auxin-responsive protein SAUR21-like [Brassica napus]) HSP 1 Score: 120.9 bits (302), Expect = 1.0e-24 Identity = 55/72 (76.39%), Postives = 63/72 (87.50%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |