Cla006954 (gene) Watermelon (97103) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTCAATCTCACATCTTCCTTCACTACCTTCTTCCATAGGAACATTATTACCTCAAAACCCTTCTTCAAGAAATCCCTAAACAACCAAAAGCTACCTTCTTTCACCACTTTTAACCACTTTGAGCTCCTCTTCAACCTCCTTGACTCCAATGGTGATGGAAAGATCTCCACGAAAGAGCTCCGTCGGTTTCTCTATCGCTTAGGTTATAAAAAGTTGAAAGCTAGAACAGAAGCTAAGGATATGGTGAAGGAAATGGATTCCGACCGTGATGGATGA ATGTTCAATCTCACATCTTCCTTCACTACCTTCTTCCATAGGAACATTATTACCTCAAAACCCTTCTTCAAGAAATCCCTAAACAACCAAAAGCTACCTTCTTTCACCACTTTTAACCACTTTGAGCTCCTCTTCAACCTCCTTGACTCCAATGGTGATGGAAAGATCTCCACGAAAGAGCTCCGTCGGTTTCTCTATCGCTTAGGTTATAAAAAGTTGAAAGCTAGAACAGAAGCTAAGGATATGGTGAAGGAAATGGATTCCGACCGTGATGGATGA ATGTTCAATCTCACATCTTCCTTCACTACCTTCTTCCATAGGAACATTATTACCTCAAAACCCTTCTTCAAGAAATCCCTAAACAACCAAAAGCTACCTTCTTTCACCACTTTTAACCACTTTGAGCTCCTCTTCAACCTCCTTGACTCCAATGGTGATGGAAAGATCTCCACGAAAGAGCTCCGTCGGTTTCTCTATCGCTTAGGTTATAAAAAGTTGAAAGCTAGAACAGAAGCTAAGGATATGGTGAAGGAAATGGATTCCGACCGTGATGGATGA MFNLTSSFTTFFHRNIITSKPFFKKSLNNQKLPSFTTFNHFELLFNLLDSNGDGKISTKELRRFLYRLGYKKLKARTEAKDMVKEMDSDRDG
BLAST of Cla006954 vs. TrEMBL
Match: A0A0A0K8Z4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G076830 PE=4 SV=1) HSP 1 Score: 157.5 bits (397), Expect = 7.6e-36 Identity = 80/93 (86.02%), Postives = 87/93 (93.55%), Query Frame = 1
BLAST of Cla006954 vs. TrEMBL
Match: A0A067JXS4_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_14512 PE=4 SV=1) HSP 1 Score: 63.5 bits (153), Expect = 1.5e-07 Identity = 40/97 (41.24%), Postives = 56/97 (57.73%), Query Frame = 1
BLAST of Cla006954 vs. TrEMBL
Match: A0A067JXS4_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_14512 PE=4 SV=1) HSP 1 Score: 40.4 bits (93), Expect = 1.4e+00 Identity = 20/48 (41.67%), Postives = 32/48 (66.67%), Query Frame = 1
HSP 2 Score: 61.2 bits (147), Expect = 7.5e-07 Identity = 32/63 (50.79%), Postives = 42/63 (66.67%), Query Frame = 1
BLAST of Cla006954 vs. TrEMBL
Match: B9RDE4_RICCO (Calmodulin, putative OS=Ricinus communis GN=RCOM_1612330 PE=4 SV=1) HSP 1 Score: 31.2 bits (69), Expect = 8.3e+02 Identity = 16/48 (33.33%), Postives = 28/48 (58.33%), Query Frame = 1
HSP 2 Score: 59.7 bits (143), Expect = 2.2e-06 Identity = 28/61 (45.90%), Postives = 41/61 (67.21%), Query Frame = 1
BLAST of Cla006954 vs. TrEMBL
Match: W9QZX9_9ROSA (Putative calcium-binding protein CML25 OS=Morus notabilis GN=L484_022442 PE=4 SV=1) HSP 1 Score: 59.3 bits (142), Expect = 2.8e-06 Identity = 29/54 (53.70%), Postives = 37/54 (68.52%), Query Frame = 1
BLAST of Cla006954 vs. NCBI nr
Match: gi|449470826|ref|XP_004153117.1| (PREDICTED: calmodulin-beta-like [Cucumis sativus]) HSP 1 Score: 157.5 bits (397), Expect = 1.1e-35 Identity = 80/93 (86.02%), Postives = 87/93 (93.55%), Query Frame = 1
BLAST of Cla006954 vs. NCBI nr
Match: gi|659120319|ref|XP_008460131.1| (PREDICTED: calmodulin-beta-like [Cucumis melo]) HSP 1 Score: 156.4 bits (394), Expect = 2.4e-35 Identity = 79/93 (84.95%), Postives = 86/93 (92.47%), Query Frame = 1
BLAST of Cla006954 vs. NCBI nr
Match: gi|802699492|ref|XP_012083557.1| (PREDICTED: probable calcium-binding protein CML27 [Jatropha curcas]) HSP 1 Score: 63.5 bits (153), Expect = 2.2e-07 Identity = 40/97 (41.24%), Postives = 56/97 (57.73%), Query Frame = 1
BLAST of Cla006954 vs. NCBI nr
Match: gi|802699492|ref|XP_012083557.1| (PREDICTED: probable calcium-binding protein CML27 [Jatropha curcas]) HSP 1 Score: 40.4 bits (93), Expect = 2.0e+00 Identity = 20/48 (41.67%), Postives = 32/48 (66.67%), Query Frame = 1
HSP 2 Score: 63.5 bits (153), Expect = 2.2e-07 Identity = 39/95 (41.05%), Postives = 57/95 (60.00%), Query Frame = 1
BLAST of Cla006954 vs. NCBI nr
Match: gi|502104851|ref|XP_004492663.1| (PREDICTED: calmodulin-like protein 3 [Cicer arietinum]) HSP 1 Score: 32.3 bits (72), Expect = 5.3e+02 Identity = 17/48 (35.42%), Postives = 27/48 (56.25%), Query Frame = 1
HSP 2 Score: 61.2 bits (147), Expect = 1.1e-06 Identity = 32/63 (50.79%), Postives = 42/63 (66.67%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |