MELO3C022506 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTAAATCTTACATCTTCCTTGTTCTCTACCTTCTTCCATAGGAATATTACCTCCAAACCCTTCTTCCAAAAATCCCTAAACAACCAAAAGTTACCATCTTTCACCACTTTTAACCACTTCCAGCTTCTCTTCAACATCCTTGACTCCGGTGGTGACGGCAAGATCTCGACGAAAGAGCTCAGTCAATTTCTCTATCGTTTAGGTTATAAAAAGCTGAAAGCTACAATGGAAGCTGAAGAAATGGTGAAGGAAATGGATTCAGACCGTGATGGATTCATCGAAATGGACGAATTTTTAGAGTGA ATGTTAAATCTTACATCTTCCTTGTTCTCTACCTTCTTCCATAGGAATATTACCTCCAAACCCTTCTTCCAAAAATCCCTAAACAACCAAAAGTTACCATCTTTCACCACTTTTAACCACTTCCAGCTTCTCTTCAACATCCTTGACTCCGGTGGTGACGGCAAGATCTCGACGAAAGAGCTCAGTCAATTTCTCTATCGTTTAGGTTATAAAAAGCTGAAAGCTACAATGGAAGCTGAAGAAATGGTGAAGGAAATGGATTCAGACCGTGATGGATTCATCGAAATGGACGAATTTTTAGAGTGA ATGTTAAATCTTACATCTTCCTTGTTCTCTACCTTCTTCCATAGGAATATTACCTCCAAACCCTTCTTCCAAAAATCCCTAAACAACCAAAAGTTACCATCTTTCACCACTTTTAACCACTTCCAGCTTCTCTTCAACATCCTTGACTCCGGTGGTGACGGCAAGATCTCGACGAAAGAGCTCAGTCAATTTCTCTATCGTTTAGGTTATAAAAAGCTGAAAGCTACAATGGAAGCTGAAGAAATGGTGAAGGAAATGGATTCAGACCGTGATGGATTCATCGAAATGGACGAATTTTTAGAGTGA MLNLTSSLFSTFFHRNITSKPFFQKSLNNQKLPSFTTFNHFQLLFNILDSGGDGKISTKELSQFLYRLGYKKLKATMEAEEMVKEMDSDRDGFIEMDEFLE*
BLAST of MELO3C022506 vs. TrEMBL
Match: A0A0A0K8Z4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G076830 PE=4 SV=1) HSP 1 Score: 195.7 bits (496), Expect = 2.8e-47 Identity = 96/101 (95.05%), Postives = 98/101 (97.03%), Query Frame = 1
BLAST of MELO3C022506 vs. TrEMBL
Match: W9QZX9_9ROSA (Putative calcium-binding protein CML25 OS=Morus notabilis GN=L484_022442 PE=4 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 8.5e-12 Identity = 36/63 (57.14%), Postives = 47/63 (74.60%), Query Frame = 1
BLAST of MELO3C022506 vs. TrEMBL
Match: W9QZX9_9ROSA (Putative calcium-binding protein CML25 OS=Morus notabilis GN=L484_022442 PE=4 SV=1) HSP 1 Score: 38.1 bits (87), Expect = 7.5e+00 Identity = 20/60 (33.33%), Postives = 31/60 (51.67%), Query Frame = 1
HSP 2 Score: 77.0 bits (188), Expect = 1.5e-11 Identity = 38/71 (53.52%), Postives = 51/71 (71.83%), Query Frame = 1
BLAST of MELO3C022506 vs. TrEMBL
Match: B9IC08_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0014s06640g PE=4 SV=2) HSP 1 Score: 76.3 bits (186), Expect = 2.5e-11 Identity = 35/62 (56.45%), Postives = 47/62 (75.81%), Query Frame = 1
BLAST of MELO3C022506 vs. TrEMBL
Match: M5XPE3_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa025855mg PE=4 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 2.1e-10 Identity = 35/62 (56.45%), Postives = 47/62 (75.81%), Query Frame = 1
BLAST of MELO3C022506 vs. TAIR10
Match: AT5G42380.1 (AT5G42380.1 calmodulin like 37) HSP 1 Score: 50.4 bits (119), Expect = 7.4e-07 Identity = 28/77 (36.36%), Postives = 42/77 (54.55%), Query Frame = 1
BLAST of MELO3C022506 vs. TAIR10
Match: AT3G17470.1 (AT3G17470.1 Ca2+-activated RelA/spot homolog) HSP 1 Score: 49.3 bits (116), Expect = 1.6e-06 Identity = 30/76 (39.47%), Postives = 42/76 (55.26%), Query Frame = 1
BLAST of MELO3C022506 vs. TAIR10
Match: AT1G24620.1 (AT1G24620.1 EF hand calcium-binding protein family) HSP 1 Score: 48.5 bits (114), Expect = 2.8e-06 Identity = 27/81 (33.33%), Postives = 42/81 (51.85%), Query Frame = 1
HSP 2 Score: 38.5 bits (88), Expect = 2.9e-03 Identity = 23/73 (31.51%), Postives = 37/73 (50.68%), Query Frame = 1
BLAST of MELO3C022506 vs. TAIR10
Match: AT1G21550.1 (AT1G21550.1 Calcium-binding EF-hand family protein) HSP 1 Score: 48.5 bits (114), Expect = 2.8e-06 Identity = 21/55 (38.18%), Postives = 31/55 (56.36%), Query Frame = 1
BLAST of MELO3C022506 vs. TAIR10
Match: AT2G41100.1 (AT2G41100.1 Calcium-binding EF hand family protein) HSP 1 Score: 47.4 bits (111), Expect = 6.2e-06 Identity = 23/56 (41.07%), Postives = 33/56 (58.93%), Query Frame = 1
HSP 2 Score: 44.3 bits (103), Expect = 5.3e-05 Identity = 22/56 (39.29%), Postives = 31/56 (55.36%), Query Frame = 1
HSP 3 Score: 44.3 bits (103), Expect = 5.3e-05 Identity = 23/60 (38.33%), Postives = 32/60 (53.33%), Query Frame = 1
BLAST of MELO3C022506 vs. NCBI nr
Match: gi|659120319|ref|XP_008460131.1| (PREDICTED: calmodulin-beta-like [Cucumis melo]) HSP 1 Score: 204.1 bits (518), Expect = 1.1e-49 Identity = 101/101 (100.00%), Postives = 101/101 (100.00%), Query Frame = 1
BLAST of MELO3C022506 vs. NCBI nr
Match: gi|449470826|ref|XP_004153117.1| (PREDICTED: calmodulin-beta-like [Cucumis sativus]) HSP 1 Score: 195.7 bits (496), Expect = 4.0e-47 Identity = 96/101 (95.05%), Postives = 98/101 (97.03%), Query Frame = 1
BLAST of MELO3C022506 vs. NCBI nr
Match: gi|703085836|ref|XP_010092847.1| (putative calcium-binding protein CML25 [Morus notabilis]) HSP 1 Score: 77.8 bits (190), Expect = 1.2e-11 Identity = 36/63 (57.14%), Postives = 47/63 (74.60%), Query Frame = 1
BLAST of MELO3C022506 vs. NCBI nr
Match: gi|703085836|ref|XP_010092847.1| (putative calcium-binding protein CML25 [Morus notabilis]) HSP 1 Score: 38.1 bits (87), Expect = 1.1e+01 Identity = 20/60 (33.33%), Postives = 31/60 (51.67%), Query Frame = 1
HSP 2 Score: 77.0 bits (188), Expect = 2.1e-11 Identity = 38/71 (53.52%), Postives = 51/71 (71.83%), Query Frame = 1
BLAST of MELO3C022506 vs. NCBI nr
Match: gi|223548913|gb|EEF50402.1| (calmodulin, putative [Ricinus communis]) HSP 1 Score: 77.0 bits (188), Expect = 2.1e-11 Identity = 38/71 (53.52%), Postives = 51/71 (71.83%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |