MELO3C022506.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTAAATCTTACATCTTCCTTGTTCTCTACCTTCTTCCATAGGAATATTACCTCCAAACCCTTCTTCCAAAAATCCCTAAACAACCAAAAGTTACCATCTTTCACCACTTTTAACCACTTCCAGCTTCTCTTCAACATCCTTGACTCCGGTGGTGACGGCAAGATCTCGACGAAAGAGCTCAGTCAATTTCTCTATCGTTTAGGTTATAAAAAGCTGAAAGCTACAATGGAAGCTGAAGAAATGGTGAAGGAAATGGATTCAGACCGTGATGGATTCATCGAAATGGACGAATTTTTAGAGTGA ATGTTAAATCTTACATCTTCCTTGTTCTCTACCTTCTTCCATAGGAATATTACCTCCAAACCCTTCTTCCAAAAATCCCTAAACAACCAAAAGTTACCATCTTTCACCACTTTTAACCACTTCCAGCTTCTCTTCAACATCCTTGACTCCGGTGGTGACGGCAAGATCTCGACGAAAGAGCTCAGTCAATTTCTCTATCGTTTAGGTTATAAAAAGCTGAAAGCTACAATGGAAGCTGAAGAAATGGTGAAGGAAATGGATTCAGACCGTGATGGATTCATCGAAATGGACGAATTTTTAGAGTGA ATGTTAAATCTTACATCTTCCTTGTTCTCTACCTTCTTCCATAGGAATATTACCTCCAAACCCTTCTTCCAAAAATCCCTAAACAACCAAAAGTTACCATCTTTCACCACTTTTAACCACTTCCAGCTTCTCTTCAACATCCTTGACTCCGGTGGTGACGGCAAGATCTCGACGAAAGAGCTCAGTCAATTTCTCTATCGTTTAGGTTATAAAAAGCTGAAAGCTACAATGGAAGCTGAAGAAATGGTGAAGGAAATGGATTCAGACCGTGATGGATTCATCGAAATGGACGAATTTTTAGAGTGA MLNLTSSLFSTFFHRNITSKPFFQKSLNNQKLPSFTTFNHFQLLFNILDSGGDGKISTKELSQFLYRLGYKKLKATMEAEEMVKEMDSDRDGFIEMDEFLE
BLAST of MELO3C022506.2 vs. NCBI nr
Match: XP_008460131.1 (PREDICTED: calmodulin-like protein 7 [Cucumis melo]) HSP 1 Score: 199.5 bits (506), Expect = 5.4e-48 Identity = 101/101 (100.00%), Postives = 101/101 (100.00%), Query Frame = 0
BLAST of MELO3C022506.2 vs. NCBI nr
Match: XP_004153117.1 (PREDICTED: calmodulin-beta-like [Cucumis sativus] >KGN46235.1 hypothetical protein Csa_6G076830 [Cucumis sativus]) HSP 1 Score: 191.0 bits (484), Expect = 1.9e-45 Identity = 96/101 (95.05%), Postives = 98/101 (97.03%), Query Frame = 0
BLAST of MELO3C022506.2 vs. NCBI nr
Match: PON42182.1 (Parvalbumin [Trema orientalis]) HSP 1 Score: 75.5 bits (184), Expect = 1.2e-10 Identity = 36/63 (57.14%), Postives = 46/63 (73.02%), Query Frame = 0
BLAST of MELO3C022506.2 vs. NCBI nr
Match: XP_010092847.1 (probable calcium-binding protein CML23 [Morus notabilis] >EXB52665.1 putative calcium-binding protein CML25 [Morus notabilis]) HSP 1 Score: 75.5 bits (184), Expect = 1.2e-10 Identity = 36/63 (57.14%), Postives = 47/63 (74.60%), Query Frame = 0
BLAST of MELO3C022506.2 vs. NCBI nr
Match: XP_002511733.2 (probable calcium-binding protein CML18 [Ricinus communis]) HSP 1 Score: 75.1 bits (183), Expect = 1.5e-10 Identity = 38/71 (53.52%), Postives = 51/71 (71.83%), Query Frame = 0
BLAST of MELO3C022506.2 vs. TAIR10
Match: AT5G42380.1 (calmodulin like 37) HSP 1 Score: 48.1 bits (113), Expect = 3.6e-06 Identity = 28/77 (36.36%), Postives = 44/77 (57.14%), Query Frame = 0
BLAST of MELO3C022506.2 vs. TAIR10
Match: AT1G21550.1 (Calcium-binding EF-hand family protein) HSP 1 Score: 46.6 bits (109), Expect = 1.1e-05 Identity = 21/55 (38.18%), Postives = 33/55 (60.00%), Query Frame = 0
BLAST of MELO3C022506.2 vs. TAIR10
Match: AT1G24620.1 (EF hand calcium-binding protein family) HSP 1 Score: 45.8 bits (107), Expect = 1.8e-05 Identity = 27/81 (33.33%), Postives = 44/81 (54.32%), Query Frame = 0
BLAST of MELO3C022506.2 vs. TAIR10
Match: AT2G41100.1 (Calcium-binding EF hand family protein) HSP 1 Score: 45.8 bits (107), Expect = 1.8e-05 Identity = 23/56 (41.07%), Postives = 34/56 (60.71%), Query Frame = 0
BLAST of MELO3C022506.2 vs. TAIR10
Match: AT3G43810.1 (calmodulin 7) HSP 1 Score: 45.4 bits (106), Expect = 2.4e-05 Identity = 24/62 (38.71%), Postives = 38/62 (61.29%), Query Frame = 0
BLAST of MELO3C022506.2 vs. Swiss-Prot
Match: sp|Q0DJV6|CML18_ORYSJ (Probable calcium-binding protein CML18 OS=Oryza sativa subsp. japonica OX=39947 GN=CML18 PE=2 SV=1) HSP 1 Score: 48.1 bits (113), Expect = 6.5e-05 Identity = 26/56 (46.43%), Postives = 34/56 (60.71%), Query Frame = 0
BLAST of MELO3C022506.2 vs. Swiss-Prot
Match: sp|Q0IUU4|CML2_ORYSJ (Putative calmodulin-like protein 2 OS=Oryza sativa subsp. japonica OX=39947 GN=CML2 PE=3 SV=2) HSP 1 Score: 48.1 bits (113), Expect = 6.5e-05 Identity = 26/60 (43.33%), Postives = 38/60 (63.33%), Query Frame = 0
BLAST of MELO3C022506.2 vs. Swiss-Prot
Match: sp|Q9FIH9|CML37_ARATH (Calcium-binding protein CML37 OS=Arabidopsis thaliana OX=3702 GN=CML37 PE=2 SV=1) HSP 1 Score: 48.1 bits (113), Expect = 6.5e-05 Identity = 28/77 (36.36%), Postives = 44/77 (57.14%), Query Frame = 0
BLAST of MELO3C022506.2 vs. Swiss-Prot
Match: sp|Q0IQB6|CML3_ORYSJ (Calmodulin-like protein 3 OS=Oryza sativa subsp. japonica OX=39947 GN=CML3 PE=2 SV=1) HSP 1 Score: 48.1 bits (113), Expect = 6.5e-05 Identity = 26/60 (43.33%), Postives = 38/60 (63.33%), Query Frame = 0
BLAST of MELO3C022506.2 vs. Swiss-Prot
Match: sp|P80322|TNNC_BRALA (Troponin C OS=Branchiostoma lanceolatum OX=7740 PE=1 SV=1) HSP 1 Score: 48.1 bits (113), Expect = 6.5e-05 Identity = 25/63 (39.68%), Postives = 38/63 (60.32%), Query Frame = 0
BLAST of MELO3C022506.2 vs. TrEMBL
Match: tr|A0A1S3CBX8|A0A1S3CBX8_CUCME (calmodulin-like protein 7 OS=Cucumis melo OX=3656 GN=LOC103499032 PE=4 SV=1) HSP 1 Score: 199.5 bits (506), Expect = 3.6e-48 Identity = 101/101 (100.00%), Postives = 101/101 (100.00%), Query Frame = 0
BLAST of MELO3C022506.2 vs. TrEMBL
Match: tr|A0A0A0K8Z4|A0A0A0K8Z4_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G076830 PE=4 SV=1) HSP 1 Score: 191.0 bits (484), Expect = 1.3e-45 Identity = 96/101 (95.05%), Postives = 98/101 (97.03%), Query Frame = 0
BLAST of MELO3C022506.2 vs. TrEMBL
Match: tr|W9QZX9|W9QZX9_9ROSA (Putative calcium-binding protein CML25 OS=Morus notabilis OX=981085 GN=L484_022442 PE=4 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 7.7e-11 Identity = 36/63 (57.14%), Postives = 47/63 (74.60%), Query Frame = 0
BLAST of MELO3C022506.2 vs. TrEMBL
Match: tr|A0A2P5B057|A0A2P5B057_9ROSA (Parvalbumin OS=Trema orientalis OX=63057 GN=TorRG33x02_336390 PE=4 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 7.7e-11 Identity = 36/63 (57.14%), Postives = 46/63 (73.02%), Query Frame = 0
BLAST of MELO3C022506.2 vs. TrEMBL
Match: tr|B9RDE4|B9RDE4_RICCO (Calmodulin, putative OS=Ricinus communis OX=3988 GN=RCOM_1612330 PE=4 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 1.0e-10 Identity = 38/71 (53.52%), Postives = 51/71 (71.83%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |