Cla005277 (gene) Watermelon (97103) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGAGACTCACAAGTATCATTGCCTTCTTCGCGGTGGCTTTGCTGGTTGCAGATGCCTACGCCCACCGCACCACCATCACCACCGTCGAAGTGGACGATGACAACCAAAGGCAGCAGGAGAGGTGCCGCCAGATGAGGGCGCACGAGGAGATCGGCAGCTGTGCCCAGTATCTGTCGCAGCAGAGCAGGTATGTTTTGCAGATGCGCGGAATTGACAACCAAAGAAGGAGAGAAGGACATGCCTTTGAAGAGTGCTGCAATGAGCTGAGGAATGTGGATGAGGAATGCAGGTGCGAACTGCTGGAGGAAATTGCTATGGAGGAGCAGAGGAGAGCACGAGGCCAAGAAGGAAGGCAGATGCTTCAGAGAGCTAGAAACTTGCCATCCATGTGTGGAATGCGCCCACAACAATGCTACTTCTAA ATGGCGAGACTCACAAGTATCATTGCCTTCTTCGCGGTGGCTTTGCTGGTTGCAGATGCCTACGCCCACCGCACCACCATCACCACCGTCGAAGTGGACGATGACAACCAAAGGCAGCAGGAGAGGTGCCGCCAGATGAGGGCGCACGAGGAGATCGGCAGCTGTGCCCAGTATCTGTCGCAGCAGAGCAGGTATGTTTTGCAGATGCGCGGAATTGACAACCAAAGAAGGAGAGAAGGACATGCCTTTGAAGAGTGCTGCAATGAGCTGAGGAATGTGGATGAGGAATGCAGGTGCGAACTGCTGGAGGAAATTGCTATGGAGGAGCAGAGGAGAGCACGAGGCCAAGAAGGAAGGCAGATGCTTCAGAGAGCTAGAAACTTGCCATCCATGTGTGGAATGCGCCCACAACAATGCTACTTCTAA ATGGCGAGACTCACAAGTATCATTGCCTTCTTCGCGGTGGCTTTGCTGGTTGCAGATGCCTACGCCCACCGCACCACCATCACCACCGTCGAAGTGGACGATGACAACCAAAGGCAGCAGGAGAGGTGCCGCCAGATGAGGGCGCACGAGGAGATCGGCAGCTGTGCCCAGTATCTGTCGCAGCAGAGCAGGTATGTTTTGCAGATGCGCGGAATTGACAACCAAAGAAGGAGAGAAGGACATGCCTTTGAAGAGTGCTGCAATGAGCTGAGGAATGTGGATGAGGAATGCAGGTGCGAACTGCTGGAGGAAATTGCTATGGAGGAGCAGAGGAGAGCACGAGGCCAAGAAGGAAGGCAGATGCTTCAGAGAGCTAGAAACTTGCCATCCATGTGTGGAATGCGCCCACAACAATGCTACTTCTAA MARLTSIIAFFAVALLVADAYAHRTTITTVEVDDDNQRQQERCRQMRAHEEIGSCAQYLSQQSRYVLQMRGIDNQRRREGHAFEECCNELRNVDEECRCELLEEIAMEEQRRARGQEGRQMLQRARNLPSMCGMRPQQCYF
BLAST of Cla005277 vs. Swiss-Prot
Match: 2SS_CUCMA (2S albumin OS=Cucurbita maxima PE=1 SV=1) HSP 1 Score: 224.6 bits (571), Expect = 7.0e-58 Identity = 109/141 (77.30%), Postives = 124/141 (87.94%), Query Frame = 1
BLAST of Cla005277 vs. Swiss-Prot
Match: 2SS_RICCO (2S albumin OS=Ricinus communis PE=1 SV=2) HSP 1 Score: 94.0 bits (232), Expect = 1.4e-18 Identity = 54/149 (36.24%), Postives = 91/149 (61.07%), Query Frame = 1
BLAST of Cla005277 vs. Swiss-Prot
Match: 2SS1_BEREX (2S sulfur-rich seed storage protein 1 OS=Bertholletia excelsa GN=BE2S1 PE=1 SV=2) HSP 1 Score: 85.9 bits (211), Expect = 3.9e-16 Identity = 52/146 (35.62%), Postives = 77/146 (52.74%), Query Frame = 1
BLAST of Cla005277 vs. Swiss-Prot
Match: 2SS2_BEREX (2S sulfur-rich seed storage protein 2 OS=Bertholletia excelsa GN=BE2S2 PE=3 SV=1) HSP 1 Score: 81.3 bits (199), Expect = 9.6e-15 Identity = 45/146 (30.82%), Postives = 76/146 (52.05%), Query Frame = 1
BLAST of Cla005277 vs. Swiss-Prot
Match: 2SS1_SESIN (2S seed storage protein 1 OS=Sesamum indicum PE=2 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 1.8e-13 Identity = 48/142 (33.80%), Postives = 70/142 (49.30%), Query Frame = 1
BLAST of Cla005277 vs. TrEMBL
Match: A0A0A0L7Q2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G080340 PE=4 SV=1) HSP 1 Score: 231.9 bits (590), Expect = 4.9e-58 Identity = 114/141 (80.85%), Postives = 125/141 (88.65%), Query Frame = 1
BLAST of Cla005277 vs. TrEMBL
Match: A0A0U1Z284_TRIKI (Alpha-amylase inhibitor OS=Trichosanthes kirilowii GN=AAI PE=2 SV=1) HSP 1 Score: 221.1 bits (562), Expect = 8.6e-55 Identity = 106/141 (75.18%), Postives = 123/141 (87.23%), Query Frame = 1
BLAST of Cla005277 vs. TrEMBL
Match: Q8L694_MOMCH (Napin OS=Momordica charantia GN=napin PE=2 SV=1) HSP 1 Score: 171.0 bits (432), Expect = 1.0e-39 Identity = 80/141 (56.74%), Postives = 107/141 (75.89%), Query Frame = 1
BLAST of Cla005277 vs. TrEMBL
Match: A0A0M5WZ27_MOMCH (AdMc1 protein OS=Momordica charantia GN=adMc1 PE=2 SV=1) HSP 1 Score: 166.8 bits (421), Expect = 1.9e-38 Identity = 84/141 (59.57%), Postives = 107/141 (75.89%), Query Frame = 1
BLAST of Cla005277 vs. TrEMBL
Match: D0PWG2_CORAV (2S albumin OS=Corylus avellana PE=2 SV=1) HSP 1 Score: 121.7 bits (304), Expect = 7.1e-25 Identity = 62/144 (43.06%), Postives = 90/144 (62.50%), Query Frame = 1
BLAST of Cla005277 vs. NCBI nr
Match: gi|778676144|ref|XP_011650534.1| (PREDICTED: 2S albumin-like [Cucumis sativus]) HSP 1 Score: 231.9 bits (590), Expect = 7.0e-58 Identity = 114/141 (80.85%), Postives = 125/141 (88.65%), Query Frame = 1
BLAST of Cla005277 vs. NCBI nr
Match: gi|68564970|sp|Q39649.1|2SS_CUCMA (RecName: Full=2S albumin; Contains: RecName: Full=2S albumin small chain; Contains: RecName: Full=2S albumin large chain; Flags: Precursor [Cucurbita maxima]) HSP 1 Score: 224.6 bits (571), Expect = 1.1e-55 Identity = 109/141 (77.30%), Postives = 126/141 (89.36%), Query Frame = 1
BLAST of Cla005277 vs. NCBI nr
Match: gi|758343810|gb|AJO68010.1| (alpha-amylase inhibitor [Trichosanthes kirilowii]) HSP 1 Score: 221.1 bits (562), Expect = 1.2e-54 Identity = 106/141 (75.18%), Postives = 123/141 (87.23%), Query Frame = 1
BLAST of Cla005277 vs. NCBI nr
Match: gi|21327881|emb|CAD32938.1| (napin [Momordica charantia]) HSP 1 Score: 171.0 bits (432), Expect = 1.5e-39 Identity = 80/141 (56.74%), Postives = 107/141 (75.89%), Query Frame = 1
BLAST of Cla005277 vs. NCBI nr
Match: gi|930584849|emb|CDG50933.1| (AdMc1 protein [Momordica charantia]) HSP 1 Score: 166.8 bits (421), Expect = 2.8e-38 Identity = 84/141 (59.57%), Postives = 107/141 (75.89%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|