ClCG06G002170 (gene) Watermelon (Charleston Gray)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGGATTGGGGGCCAGTTTTCGTAGCTGTGATTCTGTTTGTTTTGCTAACTCCAGGACTTCTCTTTCAGCTTCCCGGAAATCGCAGGTGCTTAGAGTTTGGCAACTTTCACACGAGTGCTGCTTCTATCATCGTCCATTCGATTCTCTACTTCGGTCTCATTTGCGTCTTCTTACTCGCCATCAAGGTTCATCTCTACATCGGTTCCTAA ATGGCGGATTGGGGGCCAGTTTTCGTAGCTGTGATTCTGTTTGTTTTGCTAACTCCAGGACTTCTCTTTCAGCTTCCCGGAAATCGCAGGTGCTTAGAGTTTGGCAACTTTCACACGAGTGCTGCTTCTATCATCGTCCATTCGATTCTCTACTTCGGTCTCATTTGCGTCTTCTTACTCGCCATCAAGGTTCATCTCTACATCGGTTCCTAA ATGGCGGATTGGGGGCCAGTTTTCGTAGCTGTGATTCTGTTTGTTTTGCTAACTCCAGGACTTCTCTTTCAGCTTCCCGGAAATCGCAGGTGCTTAGAGTTTGGCAACTTTCACACGAGTGCTGCTTCTATCATCGTCCATTCGATTCTCTACTTCGGTCTCATTTGCGTCTTCTTACTCGCCATCAAGGTTCATCTCTACATCGGTTCCTAA MADWGPVFVAVILFVLLTPGLLFQLPGNRRCLEFGNFHTSAASIIVHSILYFGLICVFLLAIKVHLYIGS
BLAST of ClCG06G002170 vs. TrEMBL
Match: A0A0A0KAG8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G095300 PE=4 SV=1) HSP 1 Score: 143.3 bits (360), Expect = 1.1e-31 Identity = 68/70 (97.14%), Postives = 70/70 (100.00%), Query Frame = 1
BLAST of ClCG06G002170 vs. TrEMBL
Match: A0A067K3J9_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_17983 PE=4 SV=1) HSP 1 Score: 126.3 bits (316), Expect = 1.4e-26 Identity = 56/69 (81.16%), Postives = 65/69 (94.20%), Query Frame = 1
BLAST of ClCG06G002170 vs. TrEMBL
Match: A0A061E622_THECC (Uncharacterized protein OS=Theobroma cacao GN=TCM_008724 PE=4 SV=1) HSP 1 Score: 126.3 bits (316), Expect = 1.4e-26 Identity = 57/69 (82.61%), Postives = 66/69 (95.65%), Query Frame = 1
BLAST of ClCG06G002170 vs. TrEMBL
Match: A0A0D2T1M9_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_008G165700 PE=4 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 1.9e-26 Identity = 54/69 (78.26%), Postives = 66/69 (95.65%), Query Frame = 1
BLAST of ClCG06G002170 vs. TrEMBL
Match: A0A0D2TRC2_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_012G176700 PE=4 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 1.9e-26 Identity = 56/69 (81.16%), Postives = 66/69 (95.65%), Query Frame = 1
BLAST of ClCG06G002170 vs. TAIR10
Match: AT5G08391.1 (AT5G08391.1 Protein of unknown function (DUF 3339)) HSP 1 Score: 116.7 bits (291), Expect = 5.8e-27 Identity = 51/69 (73.91%), Postives = 60/69 (86.96%), Query Frame = 1
BLAST of ClCG06G002170 vs. TAIR10
Match: AT3G48660.1 (AT3G48660.1 Protein of unknown function (DUF 3339)) HSP 1 Score: 104.8 bits (260), Expect = 2.3e-23 Identity = 47/70 (67.14%), Postives = 57/70 (81.43%), Query Frame = 1
BLAST of ClCG06G002170 vs. TAIR10
Match: AT5G63500.1 (AT5G63500.1 Protein of unknown function (DUF 3339)) HSP 1 Score: 101.7 bits (252), Expect = 1.9e-22 Identity = 45/69 (65.22%), Postives = 55/69 (79.71%), Query Frame = 1
BLAST of ClCG06G002170 vs. TAIR10
Match: AT3G27030.1 (AT3G27030.1 unknown protein) HSP 1 Score: 97.8 bits (242), Expect = 2.8e-21 Identity = 42/66 (63.64%), Postives = 52/66 (78.79%), Query Frame = 1
HSP 2 Score: 85.5 bits (210), Expect = 1.4e-17 Identity = 34/69 (49.28%), Postives = 49/69 (71.01%), Query Frame = 1
BLAST of ClCG06G002170 vs. TAIR10
Match: AT3G01940.1 (AT3G01940.1 Protein of unknown function (DUF 3339)) HSP 1 Score: 92.0 bits (227), Expect = 1.5e-19 Identity = 41/67 (61.19%), Postives = 53/67 (79.10%), Query Frame = 1
BLAST of ClCG06G002170 vs. NCBI nr
Match: gi|659119791|ref|XP_008459846.1| (PREDICTED: uncharacterized protein LOC103498846 [Cucumis melo]) HSP 1 Score: 144.4 bits (363), Expect = 7.3e-32 Identity = 69/70 (98.57%), Postives = 70/70 (100.00%), Query Frame = 1
BLAST of ClCG06G002170 vs. NCBI nr
Match: gi|778711887|ref|XP_011656810.1| (PREDICTED: uncharacterized protein LOC101208994 [Cucumis sativus]) HSP 1 Score: 143.3 bits (360), Expect = 1.6e-31 Identity = 68/70 (97.14%), Postives = 70/70 (100.00%), Query Frame = 1
BLAST of ClCG06G002170 vs. NCBI nr
Match: gi|802724374|ref|XP_012085706.1| (PREDICTED: uncharacterized protein LOC105644831 [Jatropha curcas]) HSP 1 Score: 126.3 bits (316), Expect = 2.1e-26 Identity = 56/69 (81.16%), Postives = 65/69 (94.20%), Query Frame = 1
BLAST of ClCG06G002170 vs. NCBI nr
Match: gi|590692078|ref|XP_007043960.1| (Uncharacterized protein TCM_008724 [Theobroma cacao]) HSP 1 Score: 126.3 bits (316), Expect = 2.1e-26 Identity = 57/69 (82.61%), Postives = 66/69 (95.65%), Query Frame = 1
BLAST of ClCG06G002170 vs. NCBI nr
Match: gi|823210744|ref|XP_012438335.1| (PREDICTED: uncharacterized protein LOC105764345 [Gossypium raimondii]) HSP 1 Score: 125.9 bits (315), Expect = 2.7e-26 Identity = 54/69 (78.26%), Postives = 66/69 (95.65%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon (Charleston Gray)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|