Cp4.1LG03g12830 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGGATTGGGGTCCGGTGGTTGTAGCCGTGGTTCTGTTCATTCTGCTATCTCCAGGGCTGGTGGTTCAGGTCCATGGCGCTGAAAAGTTCATTGAGTTCGGAAATTTTGAAACCAGCGCCACCTCCATTTTCCTTCACTCCCTCATCTTCTTCGCCCTCTTCTGCCTCTTCACCCTCGTCCTCCACCTCCATATCTACATCTGA ATGGCGGATTGGGGTCCGGTGGTTGTAGCCGTGGTTCTGTTCATTCTGCTATCTCCAGGGCTGGTGGTTCAGGTCCATGGCGCTGAAAAGTTCATTGAGTTCGGAAATTTTGAAACCAGCGCCACCTCCATTTTCCTTCACTCCCTCATCTTCTTCGCCCTCTTCTGCCTCTTCACCCTCGTCCTCCACCTCCATATCTACATCTGA ATGGCGGATTGGGGTCCGGTGGTTGTAGCCGTGGTTCTGTTCATTCTGCTATCTCCAGGGCTGGTGGTTCAGGTCCATGGCGCTGAAAAGTTCATTGAGTTCGGAAATTTTGAAACCAGCGCCACCTCCATTTTCCTTCACTCCCTCATCTTCTTCGCCCTCTTCTGCCTCTTCACCCTCGTCCTCCACCTCCATATCTACATCTGA MADWGPVVVAVVLFILLSPGLVVQVHGAEKFIEFGNFETSATSIFLHSLIFFALFCLFTLVLHLHIYI
BLAST of Cp4.1LG03g12830 vs. TrEMBL
Match: A0A061EEJ7_THECC (Uncharacterized protein OS=Theobroma cacao GN=TCM_017235 PE=4 SV=1) HSP 1 Score: 88.6 bits (218), Expect = 3.2e-15 Identity = 43/68 (63.24%), Postives = 57/68 (83.82%), Query Frame = 1
BLAST of Cp4.1LG03g12830 vs. TrEMBL
Match: A0A0D9VGA2_9ORYZ (Uncharacterized protein OS=Leersia perrieri PE=4 SV=1) HSP 1 Score: 87.8 bits (216), Expect = 5.5e-15 Identity = 42/67 (62.69%), Postives = 56/67 (83.58%), Query Frame = 1
BLAST of Cp4.1LG03g12830 vs. TrEMBL
Match: A0A067LG52_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_10108 PE=4 SV=1) HSP 1 Score: 87.4 bits (215), Expect = 7.2e-15 Identity = 41/68 (60.29%), Postives = 57/68 (83.82%), Query Frame = 1
BLAST of Cp4.1LG03g12830 vs. TrEMBL
Match: Q8LBX6_ARATH (Uncharacterized protein OS=Arabidopsis thaliana GN=At5g08391 PE=2 SV=1) HSP 1 Score: 87.0 bits (214), Expect = 9.4e-15 Identity = 39/68 (57.35%), Postives = 58/68 (85.29%), Query Frame = 1
BLAST of Cp4.1LG03g12830 vs. TrEMBL
Match: M0T7L2_MUSAM (Uncharacterized protein OS=Musa acuminata subsp. malaccensis PE=4 SV=1) HSP 1 Score: 87.0 bits (214), Expect = 9.4e-15 Identity = 43/68 (63.24%), Postives = 55/68 (80.88%), Query Frame = 1
BLAST of Cp4.1LG03g12830 vs. TAIR10
Match: AT5G08391.1 (AT5G08391.1 Protein of unknown function (DUF 3339)) HSP 1 Score: 87.0 bits (214), Expect = 4.7e-18 Identity = 39/68 (57.35%), Postives = 58/68 (85.29%), Query Frame = 1
BLAST of Cp4.1LG03g12830 vs. TAIR10
Match: AT3G48660.1 (AT3G48660.1 Protein of unknown function (DUF 3339)) HSP 1 Score: 80.1 bits (196), Expect = 5.8e-16 Identity = 38/67 (56.72%), Postives = 52/67 (77.61%), Query Frame = 1
BLAST of Cp4.1LG03g12830 vs. TAIR10
Match: AT5G63500.1 (AT5G63500.1 Protein of unknown function (DUF 3339)) HSP 1 Score: 78.2 bits (191), Expect = 2.2e-15 Identity = 35/67 (52.24%), Postives = 53/67 (79.10%), Query Frame = 1
BLAST of Cp4.1LG03g12830 vs. TAIR10
Match: AT3G27030.1 (AT3G27030.1 unknown protein) HSP 1 Score: 75.5 bits (184), Expect = 1.4e-14 Identity = 36/66 (54.55%), Postives = 49/66 (74.24%), Query Frame = 1
BLAST of Cp4.1LG03g12830 vs. TAIR10
Match: AT3G01950.1 (AT3G01950.1 Protein of unknown function (DUF 3339)) HSP 1 Score: 71.6 bits (174), Expect = 2.1e-13 Identity = 33/65 (50.77%), Postives = 49/65 (75.38%), Query Frame = 1
BLAST of Cp4.1LG03g12830 vs. NCBI nr
Match: gi|449468814|ref|XP_004152116.1| (PREDICTED: uncharacterized protein LOC101215245 [Cucumis sativus]) HSP 1 Score: 118.2 bits (295), Expect = 5.4e-24 Identity = 62/68 (91.18%), Postives = 65/68 (95.59%), Query Frame = 1
BLAST of Cp4.1LG03g12830 vs. NCBI nr
Match: gi|659108087|ref|XP_008454011.1| (PREDICTED: uncharacterized protein LOC103494560 [Cucumis melo]) HSP 1 Score: 94.4 bits (233), Expect = 8.4e-17 Identity = 49/68 (72.06%), Postives = 57/68 (83.82%), Query Frame = 1
BLAST of Cp4.1LG03g12830 vs. NCBI nr
Match: gi|449468812|ref|XP_004152115.1| (PREDICTED: uncharacterized protein LOC101215007 [Cucumis sativus]) HSP 1 Score: 93.6 bits (231), Expect = 1.4e-16 Identity = 48/68 (70.59%), Postives = 56/68 (82.35%), Query Frame = 1
BLAST of Cp4.1LG03g12830 vs. NCBI nr
Match: gi|590647455|ref|XP_007031906.1| (Uncharacterized protein TCM_017235 [Theobroma cacao]) HSP 1 Score: 88.6 bits (218), Expect = 4.6e-15 Identity = 43/68 (63.24%), Postives = 57/68 (83.82%), Query Frame = 1
BLAST of Cp4.1LG03g12830 vs. NCBI nr
Match: gi|802539276|ref|XP_012070220.1| (PREDICTED: uncharacterized protein LOC105632444 [Jatropha curcas]) HSP 1 Score: 87.4 bits (215), Expect = 1.0e-14 Identity = 41/68 (60.29%), Postives = 57/68 (83.82%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|