Carg27162 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGAATTGCAAATCAATACCAAACATCACATTTTCCTATTCTTCCTCTTCTAACCATCCCTTGACTACAAGGAAAGAACTGGCTAGCAAGGTTGACTTCACTCCCTTTTTTCCCCACCCGCAGCCAAATCGACCCAGAAAGCATTCACGACCCGCTGTCAAACTCGAACCGCCCGACTCTGCTGCAGACGACGTTGATCCGCTCTACGGGGTTGAGAAGCGGCGTGTTCCTAATGGTCCAAACCCATTGCACAATTGA ATGAATTGCAAATCAATACCAAACATCACATTTTCCTATTCTTCCTCTTCTAACCATCCCTTGACTACAAGGAAAGAACTGGCTAGCAAGGTTGACTTCACTCCCTTTTTTCCCCACCCGCAGCCAAATCGACCCAGAAAGCATTCACGACCCGCTGTCAAACTCGAACCGCCCGACTCTGCTGCAGACGACGTTGATCCGCTCTACGGGGTTGAGAAGCGGCGTGTTCCTAATGGTCCAAACCCATTGCACAATTGA ATGAATTGCAAATCAATACCAAACATCACATTTTCCTATTCTTCCTCTTCTAACCATCCCTTGACTACAAGGAAAGAACTGGCTAGCAAGGTTGACTTCACTCCCTTTTTTCCCCACCCGCAGCCAAATCGACCCAGAAAGCATTCACGACCCGCTGTCAAACTCGAACCGCCCGACTCTGCTGCAGACGACGTTGATCCGCTCTACGGGGTTGAGAAGCGGCGTGTTCCTAATGGTCCAAACCCATTGCACAATTGA MNCKSIPNITFSYSSSSNHPLTTRKELASKVDFTPFFPHPQPNRPRKHSRPAVKLEPPDSAADDVDPLYGVEKRRVPNGPNPLHN
BLAST of Carg27162 vs. NCBI nr
Match: KGN51553.1 (hypothetical protein Csa_5G577440 [Cucumis sativus]) HSP 1 Score: 111.3 bits (277), Expect = 1.6e-21 Identity = 57/86 (66.28%), Postives = 62/86 (72.09%), Query Frame = 0
BLAST of Carg27162 vs. NCBI nr
Match: XP_007143789.1 (hypothetical protein PHAVU_007G101800g [Phaseolus vulgaris] >ESW15783.1 hypothetical protein PHAVU_007G101800g [Phaseolus vulgaris]) HSP 1 Score: 76.3 bits (186), Expect = 5.8e-11 Identity = 40/71 (56.34%), Postives = 48/71 (67.61%), Query Frame = 0
BLAST of Carg27162 vs. NCBI nr
Match: XP_023903065.1 (CLAVATA3/ESR (CLE)-related protein 12 [Quercus suber]) HSP 1 Score: 73.6 bits (179), Expect = 3.7e-10 Identity = 44/91 (48.35%), Postives = 53/91 (58.24%), Query Frame = 0
BLAST of Carg27162 vs. NCBI nr
Match: GAV77483.1 (hypothetical protein CFOL_v3_20954 [Cephalotus follicularis]) HSP 1 Score: 72.8 bits (177), Expect = 6.4e-10 Identity = 42/78 (53.85%), Postives = 53/78 (67.95%), Query Frame = 0
BLAST of Carg27162 vs. NCBI nr
Match: XP_021300415.1 (CLAVATA3/ESR (CLE)-related protein 12-like [Herrania umbratica]) HSP 1 Score: 72.4 bits (176), Expect = 8.3e-10 Identity = 43/85 (50.59%), Postives = 56/85 (65.88%), Query Frame = 0
BLAST of Carg27162 vs. TAIR10
Match: AT1G68795.1 (CLAVATA3/ESR-RELATED 12) HSP 1 Score: 57.4 bits (137), Expect = 5.0e-09 Identity = 31/68 (45.59%), Postives = 43/68 (63.24%), Query Frame = 0
BLAST of Carg27162 vs. TAIR10
Match: AT1G73965.1 (CLAVATA3/ESR-RELATED 13) HSP 1 Score: 47.0 bits (110), Expect = 6.8e-06 Identity = 29/63 (46.03%), Postives = 37/63 (58.73%), Query Frame = 0
BLAST of Carg27162 vs. TAIR10
Match: AT1G26600.1 (CLAVATA3/ESR-RELATED 9) HSP 1 Score: 44.3 bits (103), Expect = 4.4e-05 Identity = 22/42 (52.38%), Postives = 27/42 (64.29%), Query Frame = 0
BLAST of Carg27162 vs. TAIR10
Match: AT1G69320.1 (CLAVATA3/ESR-RELATED 10) HSP 1 Score: 41.6 bits (96), Expect = 2.9e-04 Identity = 20/40 (50.00%), Postives = 23/40 (57.50%), Query Frame = 0
BLAST of Carg27162 vs. Swiss-Prot
Match: sp|Q29PU4|CLE12_ARATH (CLAVATA3/ESR (CLE)-related protein 12 OS=Arabidopsis thaliana OX=3702 GN=CLE12 PE=2 SV=1) HSP 1 Score: 57.4 bits (137), Expect = 9.1e-08 Identity = 31/68 (45.59%), Postives = 43/68 (63.24%), Query Frame = 0
BLAST of Carg27162 vs. Swiss-Prot
Match: sp|Q6NMF0|CLE13_ARATH (CLAVATA3/ESR (CLE)-related protein 13 OS=Arabidopsis thaliana OX=3702 GN=CLE13 PE=2 SV=1) HSP 1 Score: 47.0 bits (110), Expect = 1.2e-04 Identity = 29/63 (46.03%), Postives = 37/63 (58.73%), Query Frame = 0
BLAST of Carg27162 vs. Swiss-Prot
Match: sp|Q9FZE4|CLE9_ARATH (CLAVATA3/ESR (CLE)-related protein 9 OS=Arabidopsis thaliana OX=3702 GN=CLE9 PE=2 SV=2) HSP 1 Score: 44.3 bits (103), Expect = 7.9e-04 Identity = 22/42 (52.38%), Postives = 27/42 (64.29%), Query Frame = 0
BLAST of Carg27162 vs. TrEMBL
Match: tr|A0A0A0KPQ3|A0A0A0KPQ3_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G577440 PE=4 SV=1) HSP 1 Score: 111.3 bits (277), Expect = 1.1e-21 Identity = 57/86 (66.28%), Postives = 62/86 (72.09%), Query Frame = 0
BLAST of Carg27162 vs. TrEMBL
Match: tr|V7BG00|V7BG00_PHAVU (Uncharacterized protein OS=Phaseolus vulgaris OX=3885 GN=PHAVU_007G101800g PE=4 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 3.8e-11 Identity = 40/71 (56.34%), Postives = 48/71 (67.61%), Query Frame = 0
BLAST of Carg27162 vs. TrEMBL
Match: tr|A0A2N9J7P0|A0A2N9J7P0_FAGSY (Uncharacterized protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS60537 PE=4 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 3.2e-10 Identity = 41/88 (46.59%), Postives = 49/88 (55.68%), Query Frame = 0
BLAST of Carg27162 vs. TrEMBL
Match: tr|A0A1Q3CBK6|A0A1Q3CBK6_CEPFO (Uncharacterized protein OS=Cephalotus follicularis OX=3775 GN=CFOL_v3_20954 PE=4 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 4.2e-10 Identity = 42/78 (53.85%), Postives = 53/78 (67.95%), Query Frame = 0
BLAST of Carg27162 vs. TrEMBL
Match: tr|A0A061EC34|A0A061EC34_THECC (Clavata3/esr-related 12, putative OS=Theobroma cacao OX=3641 GN=TCM_011877 PE=4 SV=1) HSP 1 Score: 70.9 bits (172), Expect = 1.6e-09 Identity = 42/85 (49.41%), Postives = 55/85 (64.71%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: None |