CmaCh04G019960 (gene) Cucurbita maxima (Rimu)
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGAATTGCAAATCAATATCAAACATCACATTTTCCTATTCTTCCTCCTCCAACCATCCCTTCACTACAAGAAAAGTACTGGCTAGCAAGGTTGACTTCACTCCCTTTTTTCCCCGCCCGAAGCCAAATAGACCCAGAAAGCATTCACGACCTGCTGTCAAACTCGAACCGCCCGACTCTGCTGCAGACGACGTTGATCCGCTCTACGGGGTTGAGAAGCGGCGTGTTCCTAATGGTCCAAACCCATTGCACAATTGA ATGAATTGCAAATCAATATCAAACATCACATTTTCCTATTCTTCCTCCTCCAACCATCCCTTCACTACAAGAAAAGTACTGGCTAGCAAGGTTGACTTCACTCCCTTTTTTCCCCGCCCGAAGCCAAATAGACCCAGAAAGCATTCACGACCTGCTGTCAAACTCGAACCGCCCGACTCTGCTGCAGACGACGTTGATCCGCTCTACGGGGTTGAGAAGCGGCGTGTTCCTAATGGTCCAAACCCATTGCACAATTGA ATGAATTGCAAATCAATATCAAACATCACATTTTCCTATTCTTCCTCCTCCAACCATCCCTTCACTACAAGAAAAGTACTGGCTAGCAAGGTTGACTTCACTCCCTTTTTTCCCCGCCCGAAGCCAAATAGACCCAGAAAGCATTCACGACCTGCTGTCAAACTCGAACCGCCCGACTCTGCTGCAGACGACGTTGATCCGCTCTACGGGGTTGAGAAGCGGCGTGTTCCTAATGGTCCAAACCCATTGCACAATTGA MNCKSISNITFSYSSSSNHPFTTRKVLASKVDFTPFFPRPKPNRPRKHSRPAVKLEPPDSAADDVDPLYGVEKRRVPNGPNPLHN
BLAST of CmaCh04G019960 vs. Swiss-Prot
Match: CLE12_ARATH (CLAVATA3/ESR (CLE)-related protein 12 OS=Arabidopsis thaliana GN=CLE12 PE=2 SV=1) HSP 1 Score: 58.5 bits (140), Expect = 4.0e-08 Identity = 30/68 (44.12%), Postives = 43/68 (63.24%), Query Frame = 1
BLAST of CmaCh04G019960 vs. TrEMBL
Match: A0A0A0KPQ3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G577440 PE=4 SV=1) HSP 1 Score: 104.0 bits (258), Expect = 9.3e-20 Identity = 55/86 (63.95%), Postives = 60/86 (69.77%), Query Frame = 1
BLAST of CmaCh04G019960 vs. TrEMBL
Match: V7BG00_PHAVU (Uncharacterized protein OS=Phaseolus vulgaris GN=PHAVU_007G101800g PE=4 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 2.3e-10 Identity = 38/71 (53.52%), Postives = 46/71 (64.79%), Query Frame = 1
BLAST of CmaCh04G019960 vs. TrEMBL
Match: B9HIY0_POPTR (Clavata3/esr-related 12 family protein OS=Populus trichocarpa GN=POPTR_0008s11450g PE=4 SV=1) HSP 1 Score: 70.9 bits (172), Expect = 8.7e-10 Identity = 44/85 (51.76%), Postives = 53/85 (62.35%), Query Frame = 1
BLAST of CmaCh04G019960 vs. TrEMBL
Match: A0A061EC34_THECC (Clavata3/esr-related 12, putative OS=Theobroma cacao GN=TCM_011877 PE=4 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 7.4e-09 Identity = 41/85 (48.24%), Postives = 55/85 (64.71%), Query Frame = 1
BLAST of CmaCh04G019960 vs. TrEMBL
Match: A0A0B2RZK0_GLYSO (CLAVATA3/ESR (CLE)-related protein 12 (Fragment) OS=Glycine soja GN=glysoja_016942 PE=4 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 1.3e-08 Identity = 40/87 (45.98%), Postives = 53/87 (60.92%), Query Frame = 1
BLAST of CmaCh04G019960 vs. TAIR10
Match: AT1G68795.1 (AT1G68795.1 CLAVATA3/ESR-RELATED 12) HSP 1 Score: 58.5 bits (140), Expect = 2.3e-09 Identity = 30/68 (44.12%), Postives = 43/68 (63.24%), Query Frame = 1
BLAST of CmaCh04G019960 vs. TAIR10
Match: AT1G73965.1 (AT1G73965.1 CLAVATA3/ESR-RELATED 13) HSP 1 Score: 46.6 bits (109), Expect = 8.9e-06 Identity = 29/63 (46.03%), Postives = 37/63 (58.73%), Query Frame = 1
BLAST of CmaCh04G019960 vs. NCBI nr
Match: gi|700196376|gb|KGN51553.1| (hypothetical protein Csa_5G577440 [Cucumis sativus]) HSP 1 Score: 104.0 bits (258), Expect = 1.3e-19 Identity = 55/86 (63.95%), Postives = 60/86 (69.77%), Query Frame = 1
BLAST of CmaCh04G019960 vs. NCBI nr
Match: gi|593686236|ref|XP_007143789.1| (hypothetical protein PHAVU_007G101800g [Phaseolus vulgaris]) HSP 1 Score: 72.8 bits (177), Expect = 3.3e-10 Identity = 38/71 (53.52%), Postives = 46/71 (64.79%), Query Frame = 1
BLAST of CmaCh04G019960 vs. NCBI nr
Match: gi|224101673|ref|XP_002312377.1| (clavata3/esr-related 12 family protein [Populus trichocarpa]) HSP 1 Score: 70.9 bits (172), Expect = 1.2e-09 Identity = 44/85 (51.76%), Postives = 53/85 (62.35%), Query Frame = 1
BLAST of CmaCh04G019960 vs. NCBI nr
Match: gi|1000981895|ref|XP_015583984.1| (PREDICTED: CLAVATA3/ESR (CLE)-related protein 12 [Ricinus communis]) HSP 1 Score: 69.3 bits (168), Expect = 3.6e-09 Identity = 36/72 (50.00%), Postives = 48/72 (66.67%), Query Frame = 1
BLAST of CmaCh04G019960 vs. NCBI nr
Match: gi|697184081|ref|XP_009601067.1| (PREDICTED: CLAVATA3/ESR (CLE)-related protein 13-like [Nicotiana tomentosiformis]) HSP 1 Score: 69.3 bits (168), Expect = 3.6e-09 Identity = 43/79 (54.43%), Postives = 51/79 (64.56%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita maxima
Date Performed: 2017-05-20
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|