Carg16431 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGAACGGATGTGAGATCTTCTGCGAAATTCTCATCGCCATTCTTATTCCTCCTCTCGGAGTCTGCCTCAAACACGGCTGTTGCACGGTAATCTTAATTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTCCGTCTCTCTCTGTAATTTCCTCCGCTAATCTGAACTTACGATGACCTAAAACAGCCGACGAGACGATCTGATCTAAAACAGACGAAATTAGGTTTCAGTTTCGGTCTAATTTTGTGTGTAATTGCAGGTGGAATTTTGTCTCTGTTTGATTTTGACTCTGCTCGGTTACATTCCGGGGATCATATACGCTCTCTACTCCATCGTGTTTGTCGATCGCGATCATTTCTTCGACGAGTACAGGCGTCCGCTCTATTCGCCGGTGCCGACGGTGTAG ATGGCGAACGGATGTGAGATCTTCTGCGAAATTCTCATCGCCATTCTTATTCCTCCTCTCGGAGTCTGCCTCAAACACGGCTGTTGCACGGTGGAATTTTGTCTCTGTTTGATTTTGACTCTGCTCGGTTACATTCCGGGGATCATATACGCTCTCTACTCCATCGTGTTTGTCGATCGCGATCATTTCTTCGACGAGTACAGGCGTCCGCTCTATTCGCCGGTGCCGACGGTGTAG ATGGCGAACGGATGTGAGATCTTCTGCGAAATTCTCATCGCCATTCTTATTCCTCCTCTCGGAGTCTGCCTCAAACACGGCTGTTGCACGGTGGAATTTTGTCTCTGTTTGATTTTGACTCTGCTCGGTTACATTCCGGGGATCATATACGCTCTCTACTCCATCGTGTTTGTCGATCGCGATCATTTCTTCGACGAGTACAGGCGTCCGCTCTATTCGCCGGTGCCGACGGTGTAG MANGCEIFCEILIAILIPPLGVCLKHGCCTVEFCLCLILTLLGYIPGIIYALYSIVFVDRDHFFDEYRRPLYSPVPTV
BLAST of Carg16431 vs. NCBI nr
Match: XP_022938010.1 (UPF0057 membrane protein At4g30660-like [Cucurbita moschata] >XP_022938011.1 UPF0057 membrane protein At4g30660-like [Cucurbita moschata]) HSP 1 Score: 165.2 bits (417), Expect = 8.7e-38 Identity = 78/78 (100.00%), Postives = 78/78 (100.00%), Query Frame = 0
BLAST of Carg16431 vs. NCBI nr
Match: XP_022969587.1 (UPF0057 membrane protein At4g30660-like [Cucurbita maxima] >XP_022969588.1 UPF0057 membrane protein At4g30660-like [Cucurbita maxima]) HSP 1 Score: 162.2 bits (409), Expect = 7.3e-37 Identity = 77/78 (98.72%), Postives = 77/78 (98.72%), Query Frame = 0
BLAST of Carg16431 vs. NCBI nr
Match: XP_022158160.1 (UPF0057 membrane protein At2g24040-like [Momordica charantia]) HSP 1 Score: 151.4 bits (381), Expect = 1.3e-33 Identity = 71/78 (91.03%), Postives = 74/78 (94.87%), Query Frame = 0
BLAST of Carg16431 vs. NCBI nr
Match: XP_022946545.1 (UPF0057 membrane protein At2g24040-like [Cucurbita moschata] >XP_022999789.1 UPF0057 membrane protein At2g24040-like [Cucurbita maxima] >XP_023523032.1 UPF0057 membrane protein At2g24040-like [Cucurbita pepo subsp. pepo] >XP_023546587.1 UPF0057 membrane protein At2g24040-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 147.1 bits (370), Expect = 2.4e-32 Identity = 70/78 (89.74%), Postives = 72/78 (92.31%), Query Frame = 0
BLAST of Carg16431 vs. NCBI nr
Match: XP_011648896.1 (PREDICTED: UPF0057 membrane protein At4g30660-like [Cucumis sativus] >KGN61055.1 hypothetical protein Csa_2G036040 [Cucumis sativus]) HSP 1 Score: 140.2 bits (352), Expect = 3.0e-30 Identity = 66/75 (88.00%), Postives = 69/75 (92.00%), Query Frame = 0
BLAST of Carg16431 vs. TAIR10
Match: AT4G28088.1 (Low temperature and salt responsive protein family) HSP 1 Score: 134.4 bits (337), Expect = 3.0e-32 Identity = 61/72 (84.72%), Postives = 68/72 (94.44%), Query Frame = 0
BLAST of Carg16431 vs. TAIR10
Match: AT2G24040.1 (Low temperature and salt responsive protein family) HSP 1 Score: 119.8 bits (299), Expect = 7.6e-28 Identity = 52/72 (72.22%), Postives = 64/72 (88.89%), Query Frame = 0
BLAST of Carg16431 vs. TAIR10
Match: AT4G30660.1 (Low temperature and salt responsive protein family) HSP 1 Score: 117.5 bits (293), Expect = 3.8e-27 Identity = 51/73 (69.86%), Postives = 63/73 (86.30%), Query Frame = 0
BLAST of Carg16431 vs. TAIR10
Match: AT4G30650.1 (Low temperature and salt responsive protein family) HSP 1 Score: 101.3 bits (251), Expect = 2.8e-22 Identity = 47/61 (77.05%), Postives = 55/61 (90.16%), Query Frame = 0
BLAST of Carg16431 vs. TAIR10
Match: AT2G38905.1 (Low temperature and salt responsive protein family) HSP 1 Score: 68.9 bits (167), Expect = 1.5e-12 Identity = 34/53 (64.15%), Postives = 45/53 (84.91%), Query Frame = 0
BLAST of Carg16431 vs. Swiss-Prot
Match: sp|O82232|RC22_ARATH (UPF0057 membrane protein At2g24040 OS=Arabidopsis thaliana OX=3702 GN=At2g24040 PE=3 SV=1) HSP 1 Score: 119.8 bits (299), Expect = 1.4e-26 Identity = 52/72 (72.22%), Postives = 64/72 (88.89%), Query Frame = 0
BLAST of Carg16431 vs. Swiss-Prot
Match: sp|Q9SUI0|RC24_ARATH (UPF0057 membrane protein At4g30660 OS=Arabidopsis thaliana OX=3702 GN=At4g30660 PE=3 SV=1) HSP 1 Score: 117.5 bits (293), Expect = 6.8e-26 Identity = 51/73 (69.86%), Postives = 63/73 (86.30%), Query Frame = 0
BLAST of Carg16431 vs. Swiss-Prot
Match: sp|Q9M095|RC23_ARATH (UPF0057 membrane protein At4g30650 OS=Arabidopsis thaliana OX=3702 GN=At4g30650 PE=3 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 5.0e-21 Identity = 47/61 (77.05%), Postives = 55/61 (90.16%), Query Frame = 0
BLAST of Carg16431 vs. Swiss-Prot
Match: sp|Q9LRI7|OSR8_ORYSJ (Hydrophobic protein OSR8 OS=Oryza sativa subsp. japonica OX=39947 GN=OSR8 PE=3 SV=1) HSP 1 Score: 87.8 bits (216), Expect = 5.8e-17 Identity = 41/68 (60.29%), Postives = 56/68 (82.35%), Query Frame = 0
BLAST of Carg16431 vs. Swiss-Prot
Match: sp|Q9ZNQ7|RCI2A_ARATH (Hydrophobic protein RCI2A OS=Arabidopsis thaliana OX=3702 GN=RCI2A PE=2 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 5.2e-10 Identity = 33/46 (71.74%), Postives = 40/46 (86.96%), Query Frame = 0
BLAST of Carg16431 vs. TrEMBL
Match: tr|A0A0A0LGN1|A0A0A0LGN1_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G036040 PE=4 SV=1) HSP 1 Score: 140.2 bits (352), Expect = 2.0e-30 Identity = 66/75 (88.00%), Postives = 69/75 (92.00%), Query Frame = 0
BLAST of Carg16431 vs. TrEMBL
Match: tr|A0A1S3BTY7|A0A1S3BTY7_CUCME (UPF0057 membrane protein At4g30660 OS=Cucumis melo OX=3656 GN=LOC103493660 PE=4 SV=1) HSP 1 Score: 139.0 bits (349), Expect = 4.4e-30 Identity = 65/73 (89.04%), Postives = 68/73 (93.15%), Query Frame = 0
BLAST of Carg16431 vs. TrEMBL
Match: tr|A0A1S3B9R0|A0A1S3B9R0_CUCME (UPF0057 membrane protein At4g30660 OS=Cucumis melo OX=3656 GN=LOC103487341 PE=4 SV=1) HSP 1 Score: 138.7 bits (348), Expect = 5.7e-30 Identity = 61/74 (82.43%), Postives = 70/74 (94.59%), Query Frame = 0
BLAST of Carg16431 vs. TrEMBL
Match: tr|A0A2N9FWW4|A0A2N9FWW4_FAGSY (Uncharacterized protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS19620 PE=4 SV=1) HSP 1 Score: 138.3 bits (347), Expect = 7.5e-30 Identity = 63/74 (85.14%), Postives = 71/74 (95.95%), Query Frame = 0
BLAST of Carg16431 vs. TrEMBL
Match: tr|A0A2H5P874|A0A2H5P874_CITUN (Uncharacterized protein OS=Citrus unshiu OX=55188 GN=CUMW_112610 PE=4 SV=1) HSP 1 Score: 137.1 bits (344), Expect = 1.7e-29 Identity = 59/76 (77.63%), Postives = 71/76 (93.42%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|