Carg12096 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTCGCTCTTTCTCCAACGTTAAGGTCCTCTCCGCTCTTGTTTCTGATGGCTTCTCTTCCGCTCTCAGCCGGTATTTCCTGTTTTTCTTGGATCTGTCTCGATTGTAGTGTTATTTTCTTTTTTTGTCGATGTTTATTTTGGTTGTTGTTTGTTTGTTTAGGCGTGGTTATGCGGCGGCTTCGCAAGGAGTTGCGTCGAGTGCGGTTAAAGGAGGAAGTGTTGCGGTGGCGAGGAGCGGTAATATGTTGAAGAAATCGGGGGAGGAGAAGGTTGTTGGATCGTCTGAGAAGGTTGCTTGGGTGCCGGATCCTGCCACTGGCTATTACAGACCGGAGAATCGCGGCGATGAGATCGATGTTGCCGAACTTCGATCGATTCTTCTTAAGAACAAGAACTGA ATGGCTCGCTCTTTCTCCAACGTTAAGGTCCTCTCCGCTCTTGTTTCTGATGGCTTCTCTTCCGCTCTCAGCCGGCGTGGTTATGCGGCGGCTTCGCAAGGAGTTGCGTCGAGTGCGGTTAAAGGAGGAAGTGTTGCGGTGGCGAGGAGCGGTAATATGTTGAAGAAATCGGGGGAGGAGAAGGTTGTTGGATCGTCTGAGAAGGTTGCTTGGGTGCCGGATCCTGCCACTGGCTATTACAGACCGGAGAATCGCGGCGATGAGATCGATGTTGCCGAACTTCGATCGATTCTTCTTAAGAACAAGAACTGA ATGGCTCGCTCTTTCTCCAACGTTAAGGTCCTCTCCGCTCTTGTTTCTGATGGCTTCTCTTCCGCTCTCAGCCGGCGTGGTTATGCGGCGGCTTCGCAAGGAGTTGCGTCGAGTGCGGTTAAAGGAGGAAGTGTTGCGGTGGCGAGGAGCGGTAATATGTTGAAGAAATCGGGGGAGGAGAAGGTTGTTGGATCGTCTGAGAAGGTTGCTTGGGTGCCGGATCCTGCCACTGGCTATTACAGACCGGAGAATCGCGGCGATGAGATCGATGTTGCCGAACTTCGATCGATTCTTCTTAAGAACAAGAACTGA MARSFSNVKVLSALVSDGFSSALSRRGYAAASQGVASSAVKGGSVAVARSGNMLKKSGEEKVVGSSEKVAWVPDPATGYYRPENRGDEIDVAELRSILLKNKN
BLAST of Carg12096 vs. NCBI nr
Match: XP_022960392.1 (indole-3-acetic acid-induced protein ARG2-like [Cucurbita moschata] >XP_023004707.1 indole-3-acetic acid-induced protein ARG2-like [Cucurbita maxima]) HSP 1 Score: 191.4 bits (485), Expect = 1.5e-45 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of Carg12096 vs. NCBI nr
Match: XP_023513499.1 (indole-3-acetic acid-induced protein ARG2-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 190.3 bits (482), Expect = 3.3e-45 Identity = 102/103 (99.03%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of Carg12096 vs. NCBI nr
Match: XP_008451558.1 (PREDICTED: indole-3-acetic acid-induced protein ARG2-like [Cucumis melo]) HSP 1 Score: 163.3 bits (412), Expect = 4.3e-37 Identity = 89/105 (84.76%), Postives = 95/105 (90.48%), Query Frame = 0
BLAST of Carg12096 vs. NCBI nr
Match: XP_022144227.1 (indole-3-acetic acid-induced protein ARG2 [Momordica charantia]) HSP 1 Score: 145.6 bits (366), Expect = 9.4e-32 Identity = 82/103 (79.61%), Postives = 89/103 (86.41%), Query Frame = 0
BLAST of Carg12096 vs. NCBI nr
Match: XP_023920362.1 (indole-3-acetic acid-induced protein ARG2 [Quercus suber] >POF00370.1 indole-3-acetic acid-induced protein arg2 [Quercus suber]) HSP 1 Score: 134.4 bits (337), Expect = 2.2e-28 Identity = 77/107 (71.96%), Postives = 86/107 (80.37%), Query Frame = 0
BLAST of Carg12096 vs. TAIR10
Match: AT4G02380.1 (senescence-associated gene 21) HSP 1 Score: 96.7 bits (239), Expect = 9.1e-21 Identity = 58/103 (56.31%), Postives = 74/103 (71.84%), Query Frame = 0
BLAST of Carg12096 vs. TAIR10
Match: AT1G02820.1 (Late embryogenesis abundant 3 (LEA3) family protein) HSP 1 Score: 82.8 bits (203), Expect = 1.4e-16 Identity = 52/102 (50.98%), Postives = 65/102 (63.73%), Query Frame = 0
BLAST of Carg12096 vs. TAIR10
Match: AT4G15910.1 (drought-induced 21) HSP 1 Score: 68.2 bits (165), Expect = 3.5e-12 Identity = 50/104 (48.08%), Postives = 61/104 (58.65%), Query Frame = 0
BLAST of Carg12096 vs. Swiss-Prot
Match: sp|P32292|ARG2_VIGRR (Indole-3-acetic acid-induced protein ARG2 OS=Vigna radiata var. radiata OX=3916 GN=ARG2 PE=2 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 4.6e-22 Identity = 61/102 (59.80%), Postives = 76/102 (74.51%), Query Frame = 0
BLAST of Carg12096 vs. Swiss-Prot
Match: sp|Q93WF6|SAG21_ARATH (Protein SENESCENCE-ASSOCIATED GENE 21, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=SAG21 PE=2 SV=1) HSP 1 Score: 96.7 bits (239), Expect = 1.6e-19 Identity = 58/103 (56.31%), Postives = 74/103 (71.84%), Query Frame = 0
BLAST of Carg12096 vs. Swiss-Prot
Match: sp|Q9SRX6|LEA2_ARATH (Late embryogenis abundant protein 2 OS=Arabidopsis thaliana OX=3702 GN=LEA2 PE=2 SV=1) HSP 1 Score: 82.8 bits (203), Expect = 2.4e-15 Identity = 52/102 (50.98%), Postives = 65/102 (63.73%), Query Frame = 0
BLAST of Carg12096 vs. Swiss-Prot
Match: sp|Q39644|LEA5_CITSI (Late embryogenesis abundant protein Lea5 OS=Citrus sinensis OX=2711 GN=LEA5 PE=2 SV=1) HSP 1 Score: 74.7 bits (182), Expect = 6.7e-13 Identity = 49/103 (47.57%), Postives = 59/103 (57.28%), Query Frame = 0
BLAST of Carg12096 vs. Swiss-Prot
Match: sp|P46522|LEA5D_GOSHI (Late embryogenesis abundant protein Lea5-D OS=Gossypium hirsutum OX=3635 GN=LEA5-D PE=2 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 1.5e-12 Identity = 45/103 (43.69%), Postives = 62/103 (60.19%), Query Frame = 0
BLAST of Carg12096 vs. TrEMBL
Match: tr|A0A1S3BRT2|A0A1S3BRT2_CUCME (indole-3-acetic acid-induced protein ARG2-like OS=Cucumis melo OX=3656 GN=LOC103492803 PE=4 SV=1) HSP 1 Score: 163.3 bits (412), Expect = 2.9e-37 Identity = 89/105 (84.76%), Postives = 95/105 (90.48%), Query Frame = 0
BLAST of Carg12096 vs. TrEMBL
Match: tr|A0A2P4L514|A0A2P4L514_QUESU (Indole-3-acetic acid-induced protein arg2 OS=Quercus suber OX=58331 GN=CFP56_71780 PE=4 SV=1) HSP 1 Score: 134.4 bits (337), Expect = 1.4e-28 Identity = 77/107 (71.96%), Postives = 86/107 (80.37%), Query Frame = 0
BLAST of Carg12096 vs. TrEMBL
Match: tr|A0A2N9I078|A0A2N9I078_FAGSY (Uncharacterized protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS1815 PE=4 SV=1) HSP 1 Score: 127.5 bits (319), Expect = 1.7e-26 Identity = 71/103 (68.93%), Postives = 80/103 (77.67%), Query Frame = 0
BLAST of Carg12096 vs. TrEMBL
Match: tr|M5VQ69|M5VQ69_PRUPE (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_8G263100 PE=4 SV=1) HSP 1 Score: 120.9 bits (302), Expect = 1.6e-24 Identity = 65/100 (65.00%), Postives = 79/100 (79.00%), Query Frame = 0
BLAST of Carg12096 vs. TrEMBL
Match: tr|A0A059AX49|A0A059AX49_EUCGR (Uncharacterized protein OS=Eucalyptus grandis OX=71139 GN=EUGRSUZ_H01104 PE=4 SV=1) HSP 1 Score: 120.9 bits (302), Expect = 1.6e-24 Identity = 68/103 (66.02%), Postives = 82/103 (79.61%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|