Carg05499 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCCGGCGTTTGGGTGTTCAAAAACGGCGTCGTTCGACTGGTGGAGAATGCCGGAGCCGATACGTCGGACGGTGGCCAGCGGTCGAGACTTCGTCGGAAAGTGCTGGTGTTCTGTTCGACGGGGGAAGTGATGACGTCATACGCAACGTTGGAACAAAAATTGATGACGTTGGGTTGGGAGCGTTATTACGATGATCCAAACCTACTGCAATTCCACAAGAGATCGACGGTCCATCTCATTTCTCTTCCAAAGGACTTTGCTAAATTCAAATCGATGCACATGTACGACATCGTCGTTAAAAACCGATCACATTTCGAAGTTAGAGAAACCTAA ATGGCCGGCGTTTGGGTGTTCAAAAACGGCGTCGTTCGACTGGTGGAGAATGCCGGAGCCGATACGTCGGACGGTGGCCAGCGGTCGAGACTTCGTCGGAAAGTGCTGGTGTTCTGTTCGACGGGGGAAGTGATGACGTCATACGCAACGTTGGAACAAAAATTGATGACGTTGGGTTGGGAGCGTTATTACGATGATCCAAACCTACTGCAATTCCACAAGAGATCGACGGTCCATCTCATTTCTCTTCCAAAGGACTTTGCTAAATTCAAATCGATGCACATGTACGACATCGTCGTTAAAAACCGATCACATTTCGAAGTTAGAGAAACCTAA ATGGCCGGCGTTTGGGTGTTCAAAAACGGCGTCGTTCGACTGGTGGAGAATGCCGGAGCCGATACGTCGGACGGTGGCCAGCGGTCGAGACTTCGTCGGAAAGTGCTGGTGTTCTGTTCGACGGGGGAAGTGATGACGTCATACGCAACGTTGGAACAAAAATTGATGACGTTGGGTTGGGAGCGTTATTACGATGATCCAAACCTACTGCAATTCCACAAGAGATCGACGGTCCATCTCATTTCTCTTCCAAAGGACTTTGCTAAATTCAAATCGATGCACATGTACGACATCGTCGTTAAAAACCGATCACATTTCGAAGTTAGAGAAACCTAA MAGVWVFKNGVVRLVENAGADTSDGGQRSRLRRKVLVFCSTGEVMTSYATLEQKLMTLGWERYYDDPNLLQFHKRSTVHLISLPKDFAKFKSMHMYDIVVKNRSHFEVRET
BLAST of Carg05499 vs. NCBI nr
Match: XP_022959407.1 (flowering-promoting factor 1-like protein 3 [Cucurbita moschata]) HSP 1 Score: 227.6 bits (579), Expect = 2.0e-56 Identity = 110/111 (99.10%), Postives = 111/111 (100.00%), Query Frame = 0
BLAST of Carg05499 vs. NCBI nr
Match: XP_023006452.1 (flowering-promoting factor 1-like protein 3 [Cucurbita maxima] >XP_023549095.1 flowering-promoting factor 1-like protein 3 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 226.1 bits (575), Expect = 5.9e-56 Identity = 109/111 (98.20%), Postives = 110/111 (99.10%), Query Frame = 0
BLAST of Carg05499 vs. NCBI nr
Match: XP_023521384.1 (flowering-promoting factor 1-like protein 1 [Cucurbita pepo subsp. pepo] >XP_023515130.1 flowering-promoting factor 1-like protein 1 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 191.0 bits (484), Expect = 2.1e-45 Identity = 91/110 (82.73%), Postives = 100/110 (90.91%), Query Frame = 0
BLAST of Carg05499 vs. NCBI nr
Match: XP_022930476.1 (flowering-promoting factor 1-like protein 1 [Cucurbita moschata]) HSP 1 Score: 189.9 bits (481), Expect = 4.7e-45 Identity = 90/110 (81.82%), Postives = 100/110 (90.91%), Query Frame = 0
BLAST of Carg05499 vs. NCBI nr
Match: XP_008458459.1 (PREDICTED: flowering-promoting factor 1-like protein 1 [Cucumis melo]) HSP 1 Score: 188.7 bits (478), Expect = 1.0e-44 Identity = 89/111 (80.18%), Postives = 99/111 (89.19%), Query Frame = 0
BLAST of Carg05499 vs. TAIR10
Match: AT5G24860.1 (flowering promoting factor 1) HSP 1 Score: 139.4 bits (350), Expect = 1.3e-33 Identity = 69/113 (61.06%), Postives = 90/113 (79.65%), Query Frame = 0
BLAST of Carg05499 vs. TAIR10
Match: AT5G10625.1 (BEST Arabidopsis thaliana protein match is: flowering promoting factor 1 (TAIR:AT5G24860.1)) HSP 1 Score: 127.9 bits (320), Expect = 4.0e-30 Identity = 63/111 (56.76%), Postives = 85/111 (76.58%), Query Frame = 0
BLAST of Carg05499 vs. TAIR10
Match: AT4G31380.1 (FPF1-like protein 1) HSP 1 Score: 107.5 bits (267), Expect = 5.5e-24 Identity = 61/123 (49.59%), Postives = 78/123 (63.41%), Query Frame = 0
BLAST of Carg05499 vs. Swiss-Prot
Match: sp|O23624|FPF1_ARATH (Flowering-promoting factor 1 OS=Arabidopsis thaliana OX=3702 GN=FPF1 PE=2 SV=1) HSP 1 Score: 139.4 bits (350), Expect = 2.4e-32 Identity = 69/113 (61.06%), Postives = 90/113 (79.65%), Query Frame = 0
BLAST of Carg05499 vs. Swiss-Prot
Match: sp|O24340|FPF1_SINAL (Flowering-promoting factor 1 OS=Sinapis alba OX=3728 GN=FPF1 PE=2 SV=1) HSP 1 Score: 139.0 bits (349), Expect = 3.1e-32 Identity = 71/116 (61.21%), Postives = 91/116 (78.45%), Query Frame = 0
BLAST of Carg05499 vs. Swiss-Prot
Match: sp|Q9LGE3|FLP1_ORYSJ (Flowering-promoting factor 1-like protein 1 OS=Oryza sativa subsp. japonica OX=39947 GN=RAA1 PE=1 SV=1) HSP 1 Score: 132.5 bits (332), Expect = 2.9e-30 Identity = 68/110 (61.82%), Postives = 81/110 (73.64%), Query Frame = 0
BLAST of Carg05499 vs. Swiss-Prot
Match: sp|Q9LXB5|FLP2_ARATH (Flowering-promoting factor 1-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=FLP2 PE=2 SV=1) HSP 1 Score: 127.9 bits (320), Expect = 7.1e-29 Identity = 63/111 (56.76%), Postives = 85/111 (76.58%), Query Frame = 0
BLAST of Carg05499 vs. Swiss-Prot
Match: sp|Q0E1D7|FLP3_ORYSJ (Flowering-promoting factor 1-like protein 3 OS=Oryza sativa subsp. japonica OX=39947 GN=Os02g0460200 PE=2 SV=1) HSP 1 Score: 127.9 bits (320), Expect = 7.1e-29 Identity = 65/112 (58.04%), Postives = 79/112 (70.54%), Query Frame = 0
BLAST of Carg05499 vs. TrEMBL
Match: tr|A0A1S3C8H5|A0A1S3C8H5_CUCME (flowering-promoting factor 1-like protein 1 OS=Cucumis melo OX=3656 GN=LOC103497861 PE=4 SV=1) HSP 1 Score: 188.7 bits (478), Expect = 6.9e-45 Identity = 89/111 (80.18%), Postives = 99/111 (89.19%), Query Frame = 0
BLAST of Carg05499 vs. TrEMBL
Match: tr|A0A061EW40|A0A061EW40_THECC (Flowering promoting factor 1 OS=Theobroma cacao OX=3641 GN=TCM_021194 PE=4 SV=1) HSP 1 Score: 174.5 bits (441), Expect = 1.3e-40 Identity = 85/111 (76.58%), Postives = 98/111 (88.29%), Query Frame = 0
BLAST of Carg05499 vs. TrEMBL
Match: tr|A0A2P5ERY2|A0A2P5ERY2_9ROSA (Flowering-promoting factor 1-like protein OS=Trema orientalis OX=63057 GN=TorRG33x02_158970 PE=4 SV=1) HSP 1 Score: 173.3 bits (438), Expect = 3.0e-40 Identity = 86/111 (77.48%), Postives = 97/111 (87.39%), Query Frame = 0
BLAST of Carg05499 vs. TrEMBL
Match: tr|B9RT38|B9RT38_RICCO (Uncharacterized protein OS=Ricinus communis OX=3988 GN=RCOM_0680830 PE=4 SV=1) HSP 1 Score: 172.2 bits (435), Expect = 6.7e-40 Identity = 84/111 (75.68%), Postives = 96/111 (86.49%), Query Frame = 0
BLAST of Carg05499 vs. TrEMBL
Match: tr|A0A067K6A6|A0A067K6A6_JATCU (Uncharacterized protein OS=Jatropha curcas OX=180498 GN=JCGZ_18865 PE=4 SV=1) HSP 1 Score: 171.8 bits (434), Expect = 8.7e-40 Identity = 84/111 (75.68%), Postives = 96/111 (86.49%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|