Cp4.1LG17g00630 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCTGGCGTTTGGGTGTTCAAAAACGGCGTCGTTCGTCTGGTGGAGGACGCCGGAGTGGATAAGGCGGATGGCGGGCAGAGGTCGACGTATCGCCGGAAAGTGCTGGTGTATAGTCCGACGGAGGAGGTGATGACGTCATATGCGGAGCTGGAACAGAAACTGACGGCGTTGGGTTGGGAACGTTACTACGACGATCCAGATCTGCTGCAATTTCACAAGAGATCAACGGTCCATCTCATTTCTCTACCCAAAGAATTCGCCAAGTTCAAATCCATGCACATGTACGACATCGTCGTCAAAAATCGAAACCATTTCGAAGTTAAAGATGCCTAA ATGTCTGGCGTTTGGGTGTTCAAAAACGGCGTCGTTCGTCTGGTGGAGGACGCCGGAGTGGATAAGGCGGATGGCGGGCAGAGGTCGACGTATCGCCGGAAAGTGCTGGTGTATAGTCCGACGGAGGAGGTGATGACGTCATATGCGGAGCTGGAACAGAAACTGACGGCGTTGGGTTGGGAACGTTACTACGACGATCCAGATCTGCTGCAATTTCACAAGAGATCAACGGTCCATCTCATTTCTCTACCCAAAGAATTCGCCAAGTTCAAATCCATGCACATGTACGACATCGTCGTCAAAAATCGAAACCATTTCGAAGTTAAAGATGCCTAA ATGTCTGGCGTTTGGGTGTTCAAAAACGGCGTCGTTCGTCTGGTGGAGGACGCCGGAGTGGATAAGGCGGATGGCGGGCAGAGGTCGACGTATCGCCGGAAAGTGCTGGTGTATAGTCCGACGGAGGAGGTGATGACGTCATATGCGGAGCTGGAACAGAAACTGACGGCGTTGGGTTGGGAACGTTACTACGACGATCCAGATCTGCTGCAATTTCACAAGAGATCAACGGTCCATCTCATTTCTCTACCCAAAGAATTCGCCAAGTTCAAATCCATGCACATGTACGACATCGTCGTCAAAAATCGAAACCATTTCGAAGTTAAAGATGCCTAA MSGVWVFKNGVVRLVEDAGVDKADGGQRSTYRRKVLVYSPTEEVMTSYAELEQKLTALGWERYYDDPDLLQFHKRSTVHLISLPKEFAKFKSMHMYDIVVKNRNHFEVKDA
BLAST of Cp4.1LG17g00630 vs. Swiss-Prot
Match: FLP3_ORYSJ (Flowering-promoting factor 1-like protein 3 OS=Oryza sativa subsp. japonica GN=Os02g0460200 PE=2 SV=1) HSP 1 Score: 140.6 bits (353), Expect = 1.0e-32 Identity = 71/115 (61.74%), Postives = 90/115 (78.26%), Query Frame = 1
BLAST of Cp4.1LG17g00630 vs. Swiss-Prot
Match: FLP1_ORYSJ (Flowering-promoting factor 1-like protein 1 OS=Oryza sativa subsp. japonica GN=RAA1 PE=1 SV=1) HSP 1 Score: 139.8 bits (351), Expect = 1.8e-32 Identity = 72/115 (62.61%), Postives = 86/115 (74.78%), Query Frame = 1
BLAST of Cp4.1LG17g00630 vs. Swiss-Prot
Match: FPF1_SINAL (Flowering-promoting factor 1 OS=Sinapis alba GN=FPF1 PE=2 SV=1) HSP 1 Score: 139.0 bits (349), Expect = 3.0e-32 Identity = 70/113 (61.95%), Postives = 87/113 (76.99%), Query Frame = 1
BLAST of Cp4.1LG17g00630 vs. Swiss-Prot
Match: FPF1_ARATH (Flowering-promoting factor 1 OS=Arabidopsis thaliana GN=FPF1 PE=2 SV=1) HSP 1 Score: 138.3 bits (347), Expect = 5.2e-32 Identity = 69/113 (61.06%), Postives = 87/113 (76.99%), Query Frame = 1
BLAST of Cp4.1LG17g00630 vs. Swiss-Prot
Match: FLP2_ORYSJ (Flowering-promoting factor 1-like protein 2 OS=Oryza sativa subsp. japonica GN=Os01g0933500 PE=2 SV=1) HSP 1 Score: 130.2 bits (326), Expect = 1.4e-29 Identity = 71/126 (56.35%), Postives = 85/126 (67.46%), Query Frame = 1
BLAST of Cp4.1LG17g00630 vs. TrEMBL
Match: A0A0A0KCC2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G194670 PE=4 SV=1) HSP 1 Score: 180.3 bits (456), Expect = 1.3e-42 Identity = 89/111 (80.18%), Postives = 97/111 (87.39%), Query Frame = 1
BLAST of Cp4.1LG17g00630 vs. TrEMBL
Match: B9RT38_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_0680830 PE=4 SV=1) HSP 1 Score: 178.3 bits (451), Expect = 5.0e-42 Identity = 86/111 (77.48%), Postives = 98/111 (88.29%), Query Frame = 1
BLAST of Cp4.1LG17g00630 vs. TrEMBL
Match: A0A061EW40_THECC (Flowering promoting factor 1 OS=Theobroma cacao GN=TCM_021194 PE=4 SV=1) HSP 1 Score: 178.3 bits (451), Expect = 5.0e-42 Identity = 86/111 (77.48%), Postives = 99/111 (89.19%), Query Frame = 1
BLAST of Cp4.1LG17g00630 vs. TrEMBL
Match: A0A067K6A6_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_18865 PE=4 SV=1) HSP 1 Score: 177.9 bits (450), Expect = 6.6e-42 Identity = 85/111 (76.58%), Postives = 99/111 (89.19%), Query Frame = 1
BLAST of Cp4.1LG17g00630 vs. TrEMBL
Match: A0A0D2NHG3_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_002G028100 PE=4 SV=1) HSP 1 Score: 176.8 bits (447), Expect = 1.5e-41 Identity = 85/111 (76.58%), Postives = 98/111 (88.29%), Query Frame = 1
BLAST of Cp4.1LG17g00630 vs. TAIR10
Match: AT5G24860.1 (AT5G24860.1 flowering promoting factor 1) HSP 1 Score: 138.3 bits (347), Expect = 2.9e-33 Identity = 69/113 (61.06%), Postives = 87/113 (76.99%), Query Frame = 1
BLAST of Cp4.1LG17g00630 vs. TAIR10
Match: AT5G10625.1 (AT5G10625.1 BEST Arabidopsis thaliana protein match is: flowering promoting factor 1 (TAIR:AT5G24860.1)) HSP 1 Score: 129.8 bits (325), Expect = 1.0e-30 Identity = 66/111 (59.46%), Postives = 83/111 (74.77%), Query Frame = 1
BLAST of Cp4.1LG17g00630 vs. TAIR10
Match: AT4G31380.1 (AT4G31380.1 FPF1-like protein 1) HSP 1 Score: 125.9 bits (315), Expect = 1.5e-29 Identity = 70/123 (56.91%), Postives = 89/123 (72.36%), Query Frame = 1
BLAST of Cp4.1LG17g00630 vs. NCBI nr
Match: gi|659117172|ref|XP_008458459.1| (PREDICTED: flowering-promoting factor 1-like protein 1 [Cucumis melo]) HSP 1 Score: 183.7 bits (465), Expect = 1.7e-43 Identity = 88/110 (80.00%), Postives = 96/110 (87.27%), Query Frame = 1
BLAST of Cp4.1LG17g00630 vs. NCBI nr
Match: gi|449450674|ref|XP_004143087.1| (PREDICTED: flowering-promoting factor 1-like protein 1 [Cucumis sativus]) HSP 1 Score: 180.3 bits (456), Expect = 1.9e-42 Identity = 89/111 (80.18%), Postives = 97/111 (87.39%), Query Frame = 1
BLAST of Cp4.1LG17g00630 vs. NCBI nr
Match: gi|1000971388|ref|XP_015573301.1| (PREDICTED: flowering-promoting factor 1-like protein 3 [Ricinus communis]) HSP 1 Score: 178.3 bits (451), Expect = 7.2e-42 Identity = 86/111 (77.48%), Postives = 98/111 (88.29%), Query Frame = 1
BLAST of Cp4.1LG17g00630 vs. NCBI nr
Match: gi|720011728|ref|XP_010259653.1| (PREDICTED: flowering-promoting factor 1-like protein 3 [Nelumbo nucifera]) HSP 1 Score: 178.3 bits (451), Expect = 7.2e-42 Identity = 87/111 (78.38%), Postives = 97/111 (87.39%), Query Frame = 1
BLAST of Cp4.1LG17g00630 vs. NCBI nr
Match: gi|590661036|ref|XP_007035563.1| (Flowering promoting factor 1 [Theobroma cacao]) HSP 1 Score: 178.3 bits (451), Expect = 7.2e-42 Identity = 86/111 (77.48%), Postives = 99/111 (89.19%), Query Frame = 1
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|