Carg01992 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: exonfive_prime_UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.TTCTTCTTCTTCTTCTTCTTCTTCCAATTCCCATGGCCCTTGTCTCTTCTAATGCTCAGTTCCATGTCTTGGCTGTTGATGACAGCCTTGTTGACAGGAAGCTGATTGAAAGGCTGCTCAAAACTTCCTCCTTCAATGGTACTCTGCCATTGAACCTTCTTCTCTCTCTTTCTCACTCTCTCTAGGGTTCTAAGAATGGCTTGAATTTAGGCTCTAAACAGTTGGTTTGGTTTTTTTCTTTTTACAGTTACGGCTGTGGATTCTGGAAGCAAGGCTTTGGAGCTTCTGGGTTTGGTTAGAGAGAGAAATGGAAGCATCCATTCTCCTTTTTCCCCTGAAAATCATAATCATCAACATCATCAAGTTAAGGATTTCCAATTTGGATGTTTGTTTGTTTGTTGTTCTTTTGGGCATTGTTTTGATTTGTTTTGCTTTGATTGCAGGAGATTGAAGTTAATCTCATCATTACAGATTACTGTATGCCAGAAATGACAGGCTATGATCTTCTAAGAAAGATCAAGGCAAGTTTCTTCTTCTTTTCAAAACATAAGGCTTAG TTCTTCTTCTTCTTCTTCTTCTTCCAATTCCCATGGCCCTTGTCTCTTCTAATGCTCAGTTCCATGTCTTGGCTGTTGATGACAGCCTTGTTGACAGGAAGCTGATTGAAAGGCTGCTCAAAACTTCCTCCTTCAATGTTACGGCTGTGGATTCTGGAAGCAAGGCTTTGGAGCTTCTGGGTTTGGTTAGAGAGAGAAATGGAAGCATCCATTCTCCTTTTTCCCCTGAAAATCATAATCATCAACATCATCAAGAGATTGAAGTTAATCTCATCATTACAGATTACTGTATGCCAGAAATGACAGGCTATGATCTTCTAAGAAAGATCAAGGCAAGTTTCTTCTTCTTTTCAAAACATAAGGCTTAG ATGGCCCTTGTCTCTTCTAATGCTCAGTTCCATGTCTTGGCTGTTGATGACAGCCTTGTTGACAGGAAGCTGATTGAAAGGCTGCTCAAAACTTCCTCCTTCAATGTTACGGCTGTGGATTCTGGAAGCAAGGCTTTGGAGCTTCTGGGTTTGGTTAGAGAGAGAAATGGAAGCATCCATTCTCCTTTTTCCCCTGAAAATCATAATCATCAACATCATCAAGAGATTGAAGTTAATCTCATCATTACAGATTACTGTATGCCAGAAATGACAGGCTATGATCTTCTAAGAAAGATCAAGGCAAGTTTCTTCTTCTTTTCAAAACATAAGGCTTAG MALVSSNAQFHVLAVDDSLVDRKLIERLLKTSSFNVTAVDSGSKALELLGLVRERNGSIHSPFSPENHNHQHHQEIEVNLIITDYCMPEMTGYDLLRKIKASFFFFSKHKA
BLAST of Carg01992 vs. NCBI nr
Match: XP_022956694.1 (LOW QUALITY PROTEIN: two-component response regulator ORR11-like [Cucurbita moschata]) HSP 1 Score: 191.0 bits (484), Expect = 2.1e-45 Identity = 98/102 (96.08%), Postives = 100/102 (98.04%), Query Frame = 0
BLAST of Carg01992 vs. NCBI nr
Match: XP_023526911.1 (two-component response regulator ORR4-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 184.5 bits (467), Expect = 2.0e-43 Identity = 95/102 (93.14%), Postives = 95/102 (93.14%), Query Frame = 0
BLAST of Carg01992 vs. NCBI nr
Match: XP_008446956.1 (PREDICTED: two-component response regulator ORR9-like [Cucumis melo]) HSP 1 Score: 171.4 bits (433), Expect = 1.7e-39 Identity = 90/104 (86.54%), Postives = 95/104 (91.35%), Query Frame = 0
BLAST of Carg01992 vs. NCBI nr
Match: XP_004142431.1 (PREDICTED: two-component response regulator ARR9-like [Cucumis sativus] >KGN52317.1 hypothetical protein Csa_5G623800 [Cucumis sativus]) HSP 1 Score: 163.7 bits (413), Expect = 3.6e-37 Identity = 88/104 (84.62%), Postives = 95/104 (91.35%), Query Frame = 0
BLAST of Carg01992 vs. NCBI nr
Match: XP_022139151.1 (two-component response regulator ORR4-like [Momordica charantia]) HSP 1 Score: 157.1 bits (396), Expect = 3.4e-35 Identity = 85/104 (81.73%), Postives = 90/104 (86.54%), Query Frame = 0
BLAST of Carg01992 vs. TAIR10
Match: AT3G57040.1 (response regulator 9) HSP 1 Score: 118.2 bits (295), Expect = 3.1e-27 Identity = 64/102 (62.75%), Postives = 76/102 (74.51%), Query Frame = 0
BLAST of Carg01992 vs. TAIR10
Match: AT2G41310.1 (response regulator 3) HSP 1 Score: 117.1 bits (292), Expect = 7.0e-27 Identity = 64/105 (60.95%), Postives = 76/105 (72.38%), Query Frame = 0
BLAST of Carg01992 vs. TAIR10
Match: AT3G48100.1 (response regulator 5) HSP 1 Score: 95.1 bits (235), Expect = 2.8e-20 Identity = 52/102 (50.98%), Postives = 68/102 (66.67%), Query Frame = 0
BLAST of Carg01992 vs. TAIR10
Match: AT1G10470.1 (response regulator 4) HSP 1 Score: 93.6 bits (231), Expect = 8.3e-20 Identity = 53/97 (54.64%), Postives = 65/97 (67.01%), Query Frame = 0
BLAST of Carg01992 vs. TAIR10
Match: AT1G74890.1 (response regulator 15) HSP 1 Score: 92.8 bits (229), Expect = 1.4e-19 Identity = 52/98 (53.06%), Postives = 69/98 (70.41%), Query Frame = 0
BLAST of Carg01992 vs. Swiss-Prot
Match: sp|Q4GZK7|ORR4_ORYSI (Two-component response regulator ORR4 OS=Oryza sativa subsp. indica OX=39946 GN=RR4 PE=2 SV=1) HSP 1 Score: 121.7 bits (304), Expect = 5.1e-27 Identity = 65/102 (63.73%), Postives = 76/102 (74.51%), Query Frame = 0
BLAST of Carg01992 vs. Swiss-Prot
Match: sp|Q942A1|ORR4_ORYSJ (Two-component response regulator ORR4 OS=Oryza sativa subsp. japonica OX=39947 GN=RR4 PE=2 SV=1) HSP 1 Score: 121.7 bits (304), Expect = 5.1e-27 Identity = 65/102 (63.73%), Postives = 76/102 (74.51%), Query Frame = 0
BLAST of Carg01992 vs. Swiss-Prot
Match: sp|Q4GZK2|ORR9_ORYSI (Two-component response regulator ORR9 OS=Oryza sativa subsp. indica OX=39946 GN=RR9 PE=2 SV=1) HSP 1 Score: 118.6 bits (296), Expect = 4.3e-26 Identity = 67/101 (66.34%), Postives = 74/101 (73.27%), Query Frame = 0
BLAST of Carg01992 vs. Swiss-Prot
Match: sp|Q2RAP3|ORR9_ORYSJ (Two-component response regulator ORR9 OS=Oryza sativa subsp. japonica OX=39947 GN=RR9 PE=2 SV=2) HSP 1 Score: 118.6 bits (296), Expect = 4.3e-26 Identity = 67/101 (66.34%), Postives = 74/101 (73.27%), Query Frame = 0
BLAST of Carg01992 vs. Swiss-Prot
Match: sp|O80366|ARR9_ARATH (Two-component response regulator ARR9 OS=Arabidopsis thaliana OX=3702 GN=ARR9 PE=1 SV=1) HSP 1 Score: 118.2 bits (295), Expect = 5.7e-26 Identity = 64/102 (62.75%), Postives = 76/102 (74.51%), Query Frame = 0
BLAST of Carg01992 vs. TrEMBL
Match: tr|A0A1S3BH64|A0A1S3BH64_CUCME (two-component response regulator ORR9-like OS=Cucumis melo OX=3656 GN=LOC103489512 PE=4 SV=1) HSP 1 Score: 171.4 bits (433), Expect = 1.1e-39 Identity = 90/104 (86.54%), Postives = 95/104 (91.35%), Query Frame = 0
BLAST of Carg01992 vs. TrEMBL
Match: tr|A0A0A0KV44|A0A0A0KV44_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G623800 PE=4 SV=1) HSP 1 Score: 163.7 bits (413), Expect = 2.4e-37 Identity = 88/104 (84.62%), Postives = 95/104 (91.35%), Query Frame = 0
BLAST of Carg01992 vs. TrEMBL
Match: tr|A0A1S3T7F9|A0A1S3T7F9_VIGRR (two-component response regulator ARR9 OS=Vigna radiata var. radiata OX=3916 GN=LOC106752532 PE=4 SV=1) HSP 1 Score: 136.3 bits (342), Expect = 4.1e-29 Identity = 68/102 (66.67%), Postives = 81/102 (79.41%), Query Frame = 0
BLAST of Carg01992 vs. TrEMBL
Match: tr|A0A2P4HC21|A0A2P4HC21_QUESU (Two-component response regulator arr9 OS=Quercus suber OX=58331 GN=CFP56_77842 PE=4 SV=1) HSP 1 Score: 135.2 bits (339), Expect = 9.0e-29 Identity = 68/103 (66.02%), Postives = 84/103 (81.55%), Query Frame = 0
BLAST of Carg01992 vs. TrEMBL
Match: tr|A0A0A0LCF4|A0A0A0LCF4_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G822100 PE=4 SV=1) HSP 1 Score: 134.4 bits (337), Expect = 1.5e-28 Identity = 69/105 (65.71%), Postives = 85/105 (80.95%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|