Bhi09G000099 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGAGCAGCATGGCAATGAAATGGGCTTTAATGGCTTGCCTGTTGCTCAGCTCGCTCTCCATCGCCAATTCCGAACCTATTCAAGATTGCTACAGCAGGTGCGTCGTCTTATGCGCCGTCACGCCTGGCATCCCCTTCTCCGACTGCCCGTCAAGATGCCTGAAATCTTGCACGAGCCCGTCTGTCAAACTACATGGGCAACAGCAAGATCATTTCAGCTGCGAGCTCGACTGTGCAATTTCCTCGTGTACCAAATTTAGCACAAAGGAAAATCCAGGTTTGAAATCTACACTCATTTAA ATGGAGAGCAGCATGGCAATGAAATGGGCTTTAATGGCTTGCCTGTTGCTCAGCTCGCTCTCCATCGCCAATTCCGAACCTATTCAAGATTGCTACAGCAGGTGCGTCGTCTTATGCGCCGTCACGCCTGGCATCCCCTTCTCCGACTGCCCGTCAAGATGCCTGAAATCTTGCACGAGCCCGTCTGTCAAACTACATGGGCAACAGCAAGATCATTTCAGCTGCGAGCTCGACTGTGCAATTTCCTCGTGTACCAAATTTAGCACAAAGGAAAATCCAGGTTTGAAATCTACACTCATTTAA ATGGAGAGCAGCATGGCAATGAAATGGGCTTTAATGGCTTGCCTGTTGCTCAGCTCGCTCTCCATCGCCAATTCCGAACCTATTCAAGATTGCTACAGCAGGTGCGTCGTCTTATGCGCCGTCACGCCTGGCATCCCCTTCTCCGACTGCCCGTCAAGATGCCTGAAATCTTGCACGAGCCCGTCTGTCAAACTACATGGGCAACAGCAAGATCATTTCAGCTGCGAGCTCGACTGTGCAATTTCCTCGTGTACCAAATTTAGCACAAAGGAAAATCCAGGTTTGAAATCTACACTCATTTAA MESSMAMKWALMACLLLSSLSIANSEPIQDCYSRCVVLCAVTPGIPFSDCPSRCLKSCTSPSVKLHGQQQDHFSCELDCAISSCTKFSTKENPGLKSTLI
BLAST of Bhi09G000099 vs. TrEMBL
Match: tr|A0A0A0K781|A0A0A0K781_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G441625 PE=4 SV=1) HSP 1 Score: 66.6 bits (161), Expect = 3.6e-08 Identity = 41/101 (40.59%), Postives = 49/101 (48.51%), Query Frame = 0
BLAST of Bhi09G000099 vs. TrEMBL
Match: tr|A0A059AI82|A0A059AI82_EUCGR (Uncharacterized protein OS=Eucalyptus grandis OX=71139 GN=EUGRSUZ_J03010 PE=4 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 8.2e-05 Identity = 29/87 (33.33%), Postives = 38/87 (43.68%), Query Frame = 0
BLAST of Bhi09G000099 vs. TrEMBL
Match: tr|A0A1S3CDU0|A0A1S3CDU0_CUCME (thionin-like protein 2 OS=Cucumis melo OX=3656 GN=LOC103499746 PE=4 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 1.1e-04 Identity = 40/106 (37.74%), Postives = 51/106 (48.11%), Query Frame = 0
BLAST of Bhi09G000099 vs. TrEMBL
Match: tr|A0A061GI20|A0A061GI20_THECC (To encode a PR protein, Belongs to the plant thionin family with the following members:, putative OS=Theobroma cacao OX=3641 GN=TCM_028643 PE=4 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 1.8e-04 Identity = 28/84 (33.33%), Postives = 38/84 (45.24%), Query Frame = 0
BLAST of Bhi09G000099 vs. TrEMBL
Match: tr|A0A1S3CDU4|A0A1S3CDU4_CUCME (thionin-like protein 2 OS=Cucumis melo OX=3656 GN=LOC103499745 PE=4 SV=1) HSP 1 Score: 53.1 bits (126), Expect = 4.1e-04 Identity = 37/95 (38.95%), Postives = 44/95 (46.32%), Query Frame = 0
BLAST of Bhi09G000099 vs. NCBI nr
Match: XP_022953260.1 (thionin-like protein 2 [Cucurbita moschata] >XP_022953261.1 thionin-like protein 2 [Cucurbita moschata]) HSP 1 Score: 82.4 bits (202), Expect = 9.5e-13 Identity = 48/105 (45.71%), Postives = 58/105 (55.24%), Query Frame = 0
BLAST of Bhi09G000099 vs. NCBI nr
Match: XP_022992447.1 (thionin-like protein 2 [Cucurbita maxima] >XP_022992448.1 thionin-like protein 2 [Cucurbita maxima]) HSP 1 Score: 82.0 bits (201), Expect = 1.2e-12 Identity = 47/104 (45.19%), Postives = 59/104 (56.73%), Query Frame = 0
BLAST of Bhi09G000099 vs. NCBI nr
Match: XP_023547567.1 (thionin-like protein 2 [Cucurbita pepo subsp. pepo] >XP_023547568.1 thionin-like protein 2 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 82.0 bits (201), Expect = 1.2e-12 Identity = 47/101 (46.53%), Postives = 57/101 (56.44%), Query Frame = 0
BLAST of Bhi09G000099 vs. NCBI nr
Match: XP_011659556.1 (PREDICTED: thionin-like protein 2 [Cucumis sativus] >KGN45343.1 hypothetical protein Csa_7G441625 [Cucumis sativus]) HSP 1 Score: 66.6 bits (161), Expect = 5.4e-08 Identity = 41/101 (40.59%), Postives = 49/101 (48.51%), Query Frame = 0
BLAST of Bhi09G000099 vs. NCBI nr
Match: KCW53757.1 (hypothetical protein EUGRSUZ_J03010 [Eucalyptus grandis]) HSP 1 Score: 55.5 bits (132), Expect = 1.2e-04 Identity = 29/87 (33.33%), Postives = 38/87 (43.68%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|