Cucsa.084630 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTGGAATTCAGTGTGACATTGTTGAAGATTTTTCAAGCGATCAAGGAGCAAAACCTTTGGAATGTGCCTATTTGGATGCCGTTATCGACGAGTTTAGATGGGGAGAAGAAAAGATCCGTGTTGGGATGGGAAGAGAAGCAAAAGAATTGGATTGAAATGCAGAAGGAGGAAGATGAAG ATGGTGGAATTCAGTGTGACATTGTTGAAGATTTTTCAAGCGATCAAGGAGCAAAACCTTTGGAATGTGCCTATTTGGATGCCGTTATCGACGAGTTTAGATGGGGAGAAGAAAAGATCCGTGTTGGGATGGGAAGAGAAGCAAAAGAATTGGATTGAAATGCAGAAGGAGGAAGATGAAG ATGGTGGAATTCAGTGTGACATTGTTGAAGATTTTTCAAGCGATCAAGGAGCAAAACCTTTGGAATGTGCCTATTTGGATGCCGTTATCGACGAGTTTAGATGGGGAGAAGAAAAGATCCGTGTTGGGATGGGAAGAGAAGCAAAAGAATTGGATTGAAATGCAGAAGGAGGAAGATGAAG MVEFSVTLLKIFQAIKEQNLWNVPIWMPLSTSLDGEKKRSVLGWEEKQKNWIEMQKEEDEX
BLAST of Cucsa.084630 vs. Swiss-Prot
Match: Y5278_ARATH (Uncharacterized protein PAM68-like OS=Arabidopsis thaliana GN=At5g52780 PE=2 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 2.4e-07 Identity = 25/72 (34.72%), Postives = 42/72 (58.33%), Query Frame = 1
BLAST of Cucsa.084630 vs. TrEMBL
Match: A0A0A0K7F4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G390080 PE=4 SV=1) HSP 1 Score: 127.1 bits (318), Expect = 7.3e-27 Identity = 60/60 (100.00%), Postives = 60/60 (100.00%), Query Frame = 1
BLAST of Cucsa.084630 vs. TrEMBL
Match: A0A0A0LLM4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G213970 PE=4 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 6.9e-17 Identity = 49/76 (64.47%), Postives = 52/76 (68.42%), Query Frame = 1
BLAST of Cucsa.084630 vs. TrEMBL
Match: A0A068UA19_COFCA (Uncharacterized protein OS=Coffea canephora GN=GSCOC_T00020082001 PE=4 SV=1) HSP 1 Score: 68.9 bits (167), Expect = 2.4e-09 Identity = 34/74 (45.95%), Postives = 46/74 (62.16%), Query Frame = 1
BLAST of Cucsa.084630 vs. TrEMBL
Match: M5X516_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa026735mg PE=4 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 4.0e-09 Identity = 33/71 (46.48%), Postives = 43/71 (60.56%), Query Frame = 1
BLAST of Cucsa.084630 vs. TrEMBL
Match: E0CUU2_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_16s0050g01260 PE=4 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 4.5e-08 Identity = 32/72 (44.44%), Postives = 44/72 (61.11%), Query Frame = 1
BLAST of Cucsa.084630 vs. TAIR10
Match: AT5G52780.1 (AT5G52780.1 Protein of unknown function (DUF3464)) HSP 1 Score: 55.5 bits (132), Expect = 1.4e-08 Identity = 25/72 (34.72%), Postives = 42/72 (58.33%), Query Frame = 1
BLAST of Cucsa.084630 vs. NCBI nr
Match: gi|700189596|gb|KGN44829.1| (hypothetical protein Csa_7G390080 [Cucumis sativus]) HSP 1 Score: 127.1 bits (318), Expect = 1.1e-26 Identity = 60/60 (100.00%), Postives = 60/60 (100.00%), Query Frame = 1
BLAST of Cucsa.084630 vs. NCBI nr
Match: gi|449465705|ref|XP_004150568.1| (PREDICTED: uncharacterized protein PAM68-like [Cucumis sativus]) HSP 1 Score: 94.0 bits (232), Expect = 9.9e-17 Identity = 49/76 (64.47%), Postives = 52/76 (68.42%), Query Frame = 1
BLAST of Cucsa.084630 vs. NCBI nr
Match: gi|659077646|ref|XP_008439311.1| (PREDICTED: uncharacterized protein PAM68-like [Cucumis melo]) HSP 1 Score: 93.2 bits (230), Expect = 1.7e-16 Identity = 48/76 (63.16%), Postives = 52/76 (68.42%), Query Frame = 1
BLAST of Cucsa.084630 vs. NCBI nr
Match: gi|694400924|ref|XP_009375538.1| (PREDICTED: uncharacterized protein PAM68-like [Pyrus x bretschneideri]) HSP 1 Score: 70.5 bits (171), Expect = 1.2e-09 Identity = 35/71 (49.30%), Postives = 44/71 (61.97%), Query Frame = 1
BLAST of Cucsa.084630 vs. NCBI nr
Match: gi|658037350|ref|XP_008354247.1| (PREDICTED: uncharacterized protein PAM68-like [Malus domestica]) HSP 1 Score: 70.5 bits (171), Expect = 1.2e-09 Identity = 35/71 (49.30%), Postives = 44/71 (61.97%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|