Csa7G018810 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTAACTCCAAGAACCCTACTTAAGCTAGCTCGTAAGTGGCAGATGGTTGCCGTGGCCGGGAACGGGCGGCGGAGGATCTCACTGCCAAGAACAAGAAGCTCCTCCTCTGTGGCGAACAAAGGCCATTTTGTAGTCTACACGGTGGACCAAAAACGGTGCGTTTTGCCCATAAGGTATTTGGGAAACTATGTTTTAAAGGAGTTGTTGAAGATGTCGGAGGAGGAGTTTGGGTTGCCTGCGGATGGACCGATAAAGCTGCCGTGTGAGGCGGCGTTTATGGAGTATATCGTGTATTTGATCCGACGACATGTTGACATTGAAGTCCAGCAAGCTCTGGTTTTGTCGGTTGTTCCAGCGGTGAAATGCTGTTGTGATTCTAGTTCGTTTTCGTCGGCAGCGCCGGTAGCTGAAAATGACCGGCCGGTGATGATTTGTGGGTTCTGA ATGGTAACTCCAAGAACCCTACTTAAGCTAGCTCGTAAGTGGCAGATGGTTGCCGTGGCCGGGAACGGGCGGCGGAGGATCTCACTGCCAAGAACAAGAAGCTCCTCCTCTGTGGCGAACAAAGGCCATTTTGTAGTCTACACGGTGGACCAAAAACGGTGCGTTTTGCCCATAAGGTATTTGGGAAACTATGTTTTAAAGGAGTTGTTGAAGATGTCGGAGGAGGAGTTTGGGTTGCCTGCGGATGGACCGATAAAGCTGCCGTGTGAGGCGGCGTTTATGGAGTATATCGTGTATTTGATCCGACGACATGTTGACATTGAAGTCCAGCAAGCTCTGGTTTTGTCGGTTGTTCCAGCGGTGAAATGCTGTTGTGATTCTAGTTCGTTTTCGTCGGCAGCGCCGGTAGCTGAAAATGACCGGCCGGTGATGATTTGTGGGTTCTGA ATGGTAACTCCAAGAACCCTACTTAAGCTAGCTCGTAAGTGGCAGATGGTTGCCGTGGCCGGGAACGGGCGGCGGAGGATCTCACTGCCAAGAACAAGAAGCTCCTCCTCTGTGGCGAACAAAGGCCATTTTGTAGTCTACACGGTGGACCAAAAACGGTGCGTTTTGCCCATAAGGTATTTGGGAAACTATGTTTTAAAGGAGTTGTTGAAGATGTCGGAGGAGGAGTTTGGGTTGCCTGCGGATGGACCGATAAAGCTGCCGTGTGAGGCGGCGTTTATGGAGTATATCGTGTATTTGATCCGACGACATGTTGACATTGAAGTCCAGCAAGCTCTGGTTTTGTCGGTTGTTCCAGCGGTGAAATGCTGTTGTGATTCTAGTTCGTTTTCGTCGGCAGCGCCGGTAGCTGAAAATGACCGGCCGGTGATGATTTGTGGGTTCTGA MVTPRTLLKLARKWQMVAVAGNGRRRISLPRTRSSSSVANKGHFVVYTVDQKRCVLPIRYLGNYVLKELLKMSEEEFGLPADGPIKLPCEAAFMEYIVYLIRRHVDIEVQQALVLSVVPAVKCCCDSSSFSSAAPVAENDRPVMICGF*
BLAST of Csa7G018810 vs. Swiss-Prot
Match: SAU63_ARATH (Auxin-responsive protein SAUR63 OS=Arabidopsis thaliana GN=SAUR63 PE=2 SV=1) HSP 1 Score: 116.7 bits (291), Expect = 2.2e-25 Identity = 62/123 (50.41%), Postives = 84/123 (68.29%), Query Frame = 1
BLAST of Csa7G018810 vs. Swiss-Prot
Match: SAU67_ARATH (Auxin-responsive protein SAUR67 OS=Arabidopsis thaliana GN=SAUR67 PE=2 SV=1) HSP 1 Score: 115.9 bits (289), Expect = 3.7e-25 Identity = 62/131 (47.33%), Postives = 86/131 (65.65%), Query Frame = 1
BLAST of Csa7G018810 vs. Swiss-Prot
Match: SAU62_ARATH (Auxin-responsive protein SAUR62 OS=Arabidopsis thaliana GN=SAUR62 PE=2 SV=1) HSP 1 Score: 115.2 bits (287), Expect = 6.3e-25 Identity = 60/123 (48.78%), Postives = 83/123 (67.48%), Query Frame = 1
BLAST of Csa7G018810 vs. Swiss-Prot
Match: SAU61_ARATH (Auxin-responsive protein SAUR61 OS=Arabidopsis thaliana GN=SAUR61 PE=2 SV=1) HSP 1 Score: 114.0 bits (284), Expect = 1.4e-24 Identity = 59/120 (49.17%), Postives = 83/120 (69.17%), Query Frame = 1
BLAST of Csa7G018810 vs. Swiss-Prot
Match: SAU64_ARATH (Auxin-responsive protein SAUR64 OS=Arabidopsis thaliana GN=SAUR64 PE=2 SV=1) HSP 1 Score: 111.3 bits (277), Expect = 9.1e-24 Identity = 57/122 (46.72%), Postives = 81/122 (66.39%), Query Frame = 1
BLAST of Csa7G018810 vs. TrEMBL
Match: A0A0A0K2P5_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G018810 PE=4 SV=1) HSP 1 Score: 298.1 bits (762), Expect = 5.9e-78 Identity = 148/148 (100.00%), Postives = 148/148 (100.00%), Query Frame = 1
BLAST of Csa7G018810 vs. TrEMBL
Match: A0A061E5H5_THECC (SAUR-like auxin-responsive protein family, putative OS=Theobroma cacao GN=TCM_006523 PE=4 SV=1) HSP 1 Score: 152.9 bits (385), Expect = 3.0e-34 Identity = 83/158 (52.53%), Postives = 108/158 (68.35%), Query Frame = 1
BLAST of Csa7G018810 vs. TrEMBL
Match: A0A0S3SE92_PHAAN (Uncharacterized protein OS=Vigna angularis var. angularis GN=Vigan.06G245500 PE=4 SV=1) HSP 1 Score: 139.4 bits (350), Expect = 3.5e-30 Identity = 76/153 (49.67%), Postives = 107/153 (69.93%), Query Frame = 1
BLAST of Csa7G018810 vs. TrEMBL
Match: A0A0L9V7Y7_PHAAN (Uncharacterized protein OS=Phaseolus angularis GN=LR48_Vigan08g193000 PE=4 SV=1) HSP 1 Score: 139.4 bits (350), Expect = 3.5e-30 Identity = 76/153 (49.67%), Postives = 107/153 (69.93%), Query Frame = 1
BLAST of Csa7G018810 vs. TrEMBL
Match: A0A059ANP6_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_I01481 PE=4 SV=1) HSP 1 Score: 136.7 bits (343), Expect = 2.3e-29 Identity = 68/140 (48.57%), Postives = 99/140 (70.71%), Query Frame = 1
BLAST of Csa7G018810 vs. TAIR10
Match: AT1G29440.1 (AT1G29440.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 116.7 bits (291), Expect = 1.2e-26 Identity = 62/123 (50.41%), Postives = 84/123 (68.29%), Query Frame = 1
BLAST of Csa7G018810 vs. TAIR10
Match: AT1G29510.1 (AT1G29510.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 115.9 bits (289), Expect = 2.1e-26 Identity = 62/131 (47.33%), Postives = 86/131 (65.65%), Query Frame = 1
BLAST of Csa7G018810 vs. TAIR10
Match: AT1G29430.1 (AT1G29430.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 115.2 bits (287), Expect = 3.6e-26 Identity = 60/123 (48.78%), Postives = 83/123 (67.48%), Query Frame = 1
BLAST of Csa7G018810 vs. TAIR10
Match: AT1G29420.1 (AT1G29420.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 114.0 bits (284), Expect = 7.9e-26 Identity = 59/120 (49.17%), Postives = 83/120 (69.17%), Query Frame = 1
BLAST of Csa7G018810 vs. TAIR10
Match: AT5G27780.1 (AT5G27780.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 111.7 bits (278), Expect = 3.9e-25 Identity = 61/137 (44.53%), Postives = 85/137 (62.04%), Query Frame = 1
BLAST of Csa7G018810 vs. NCBI nr
Match: gi|700188066|gb|KGN43299.1| (hypothetical protein Csa_7G018810 [Cucumis sativus]) HSP 1 Score: 298.1 bits (762), Expect = 8.4e-78 Identity = 148/148 (100.00%), Postives = 148/148 (100.00%), Query Frame = 1
BLAST of Csa7G018810 vs. NCBI nr
Match: gi|778723154|ref|XP_004144931.2| (PREDICTED: auxin-induced protein 6B-like [Cucumis sativus]) HSP 1 Score: 268.1 bits (684), Expect = 9.3e-69 Identity = 133/133 (100.00%), Postives = 133/133 (100.00%), Query Frame = 1
BLAST of Csa7G018810 vs. NCBI nr
Match: gi|590683862|ref|XP_007041697.1| (SAUR-like auxin-responsive protein family, putative [Theobroma cacao]) HSP 1 Score: 152.9 bits (385), Expect = 4.4e-34 Identity = 83/158 (52.53%), Postives = 108/158 (68.35%), Query Frame = 1
BLAST of Csa7G018810 vs. NCBI nr
Match: gi|920709106|gb|KOM51103.1| (hypothetical protein LR48_Vigan08g193000 [Vigna angularis]) HSP 1 Score: 139.4 bits (350), Expect = 5.0e-30 Identity = 76/153 (49.67%), Postives = 107/153 (69.93%), Query Frame = 1
BLAST of Csa7G018810 vs. NCBI nr
Match: gi|950942715|ref|XP_014493672.1| (PREDICTED: auxin-responsive protein SAUR68-like [Vigna radiata var. radiata]) HSP 1 Score: 139.0 bits (349), Expect = 6.5e-30 Identity = 75/152 (49.34%), Postives = 107/152 (70.39%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|