MELO3C033980.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGATGATAGATGATGTTGAAAAAAGAACGATATGTTTGAAGAAGTGGAAGATTGGGAGCGGGGATGTGTACTGTTTGATGACACATTGGAATTCATATGTGGAAGAACGGAGATTGAAAAGTGGAGATCATATTCAAATATGGAGCTTCAGAAAAGATGATGAAGCTGAGGGTGATCATCGACTCTGTTTTGCAATGGTAAAGCTAACCTAA ATGATGATAGATGATGTTGAAAAAAGAACGATATGTTTGAAGAAGTGGAAGATTGGGAGCGGGGATGTGTACTGTTTGATGACACATTGGAATTCATATGTGGAAGAACGGAGATTGAAAAGTGGAGATCATATTCAAATATGGAGCTTCAGAAAAGATGATGAAGCTGAGGGTGATCATCGACTCTGTTTTGCAATGGTAAAGCTAACCTAA ATGATGATAGATGATGTTGAAAAAAGAACGATATGTTTGAAGAAGTGGAAGATTGGGAGCGGGGATGTGTACTGTTTGATGACACATTGGAATTCATATGTGGAAGAACGGAGATTGAAAAGTGGAGATCATATTCAAATATGGAGCTTCAGAAAAGATGATGAAGCTGAGGGTGATCATCGACTCTGTTTTGCAATGGTAAAGCTAACCTAA MMIDDVEKRTICLKKWKIGSGDVYCLMTHWNSYVEERRLKSGDHIQIWSFRKDDEAEGDHRLCFAMVKLT
BLAST of MELO3C033980.2 vs. NCBI nr
Match: KGN51473.1 (hypothetical protein Csa_5G563790 [Cucumis sativus]) HSP 1 Score: 115.2 bits (287), Expect = 9.2e-23 Identity = 52/70 (74.29%), Postives = 61/70 (87.14%), Query Frame = 0
BLAST of MELO3C033980.2 vs. NCBI nr
Match: XP_004142863.2 (PREDICTED: B3 domain-containing protein At2g31420-like, partial [Cucumis sativus]) HSP 1 Score: 115.2 bits (287), Expect = 9.2e-23 Identity = 52/70 (74.29%), Postives = 61/70 (87.14%), Query Frame = 0
BLAST of MELO3C033980.2 vs. NCBI nr
Match: XP_016903400.1 (PREDICTED: putative B3 domain-containing protein At3g24850 [Cucumis melo]) HSP 1 Score: 111.7 bits (278), Expect = 1.0e-21 Identity = 51/70 (72.86%), Postives = 58/70 (82.86%), Query Frame = 0
BLAST of MELO3C033980.2 vs. NCBI nr
Match: XP_011656245.1 (PREDICTED: B3 domain-containing protein At2g31420-like [Cucumis sativus] >KGN51463.1 hypothetical protein Csa_5G550750 [Cucumis sativus]) HSP 1 Score: 110.9 bits (276), Expect = 1.7e-21 Identity = 51/70 (72.86%), Postives = 59/70 (84.29%), Query Frame = 0
BLAST of MELO3C033980.2 vs. NCBI nr
Match: XP_011655441.1 (PREDICTED: B3 domain-containing protein At2g31420-like [Cucumis sativus] >KGN51435.1 hypothetical protein Csa_5G544060 [Cucumis sativus]) HSP 1 Score: 108.6 bits (270), Expect = 8.6e-21 Identity = 51/70 (72.86%), Postives = 58/70 (82.86%), Query Frame = 0
BLAST of MELO3C033980.2 vs. TAIR10
Match: AT1G05920.1 (Domain of unknown function (DUF313) ) HSP 1 Score: 46.2 bits (108), Expect = 9.6e-06 Identity = 30/77 (38.96%), Postives = 38/77 (49.35%), Query Frame = 0
BLAST of MELO3C033980.2 vs. TAIR10
Match: AT1G05615.1 (Domain of unknown function (DUF313) ) HSP 1 Score: 45.4 bits (106), Expect = 1.6e-05 Identity = 23/58 (39.66%), Postives = 35/58 (60.34%), Query Frame = 0
BLAST of MELO3C033980.2 vs. Swiss-Prot
Match: sp|Q5RM09|Y1592_ARATH (B3 domain-containing protein At1g05920 OS=Arabidopsis thaliana OX=3702 GN=At1g05920 PE=2 SV=1) HSP 1 Score: 46.2 bits (108), Expect = 1.7e-04 Identity = 30/77 (38.96%), Postives = 38/77 (49.35%), Query Frame = 0
BLAST of MELO3C033980.2 vs. Swiss-Prot
Match: sp|F4I8U3|Y1056_ARATH (Putative B3 domain-containing protein At1g05615 OS=Arabidopsis thaliana OX=3702 GN=At1g05615 PE=3 SV=1) HSP 1 Score: 45.4 bits (106), Expect = 2.9e-04 Identity = 23/58 (39.66%), Postives = 35/58 (60.34%), Query Frame = 0
BLAST of MELO3C033980.2 vs. TrEMBL
Match: tr|A0A0A0KPF2|A0A0A0KPF2_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G563790 PE=4 SV=1) HSP 1 Score: 115.2 bits (287), Expect = 6.1e-23 Identity = 52/70 (74.29%), Postives = 61/70 (87.14%), Query Frame = 0
BLAST of MELO3C033980.2 vs. TrEMBL
Match: tr|A0A1S4E600|A0A1S4E600_CUCME (putative B3 domain-containing protein At3g24850 OS=Cucumis melo OX=3656 GN=LOC103504562 PE=4 SV=1) HSP 1 Score: 111.7 bits (278), Expect = 6.8e-22 Identity = 51/70 (72.86%), Postives = 58/70 (82.86%), Query Frame = 0
BLAST of MELO3C033980.2 vs. TrEMBL
Match: tr|A0A0A0KPD7|A0A0A0KPD7_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G550750 PE=4 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 1.2e-21 Identity = 51/70 (72.86%), Postives = 59/70 (84.29%), Query Frame = 0
BLAST of MELO3C033980.2 vs. TrEMBL
Match: tr|A0A0A0KP87|A0A0A0KP87_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G544060 PE=4 SV=1) HSP 1 Score: 108.6 bits (270), Expect = 5.7e-21 Identity = 51/70 (72.86%), Postives = 58/70 (82.86%), Query Frame = 0
BLAST of MELO3C033980.2 vs. TrEMBL
Match: tr|A0A0A0KUX9|A0A0A0KUX9_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G570410 PE=4 SV=1) HSP 1 Score: 106.3 bits (264), Expect = 2.8e-20 Identity = 50/69 (72.46%), Postives = 56/69 (81.16%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|