Csa5G563790 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: five_prime_UTRCDS Hold the cursor over a type above to highlight its positions in the sequence below.AAACAAAAACCATGGTCGTTTGTCGATGAACACAAAACTACTATCGTTCGATTTTGCAACCGAGGAAGAGAGCGAGTTACTGAGCGAACAAGAAAATAAGAACAAGAGGGGGATAAACGTAATGGTATTGGACGATGTTCTAGAAGAAAGAATGGTTTGTTTGAAGAAGTGGAAAATTGGAAGTGGAGAAGTTTACTGTTTGATGACACATTGGAATTCGATGGTTGAAAAAAGGGGATTGAAGAGTGGAGAAGAGATTCAAGTTTGGAGCTTCAGAAAAGATGATGAAGATGAAGCTCATCGTCTTTGCTTGGCTTTGGTTAAATTAGCAACTTGCTAA ATGAACACAAAACTACTATCGTTCGATTTTGCAACCGAGGAAGAGAGCGAGTTACTGAGCGAACAAGAAAATAAGAACAAGAGGGGGATAAACGTAATGGTATTGGACGATGTTCTAGAAGAAAGAATGGTTTGTTTGAAGAAGTGGAAAATTGGAAGTGGAGAAGTTTACTGTTTGATGACACATTGGAATTCGATGGTTGAAAAAAGGGGATTGAAGAGTGGAGAAGAGATTCAAGTTTGGAGCTTCAGAAAAGATGATGAAGATGAAGCTCATCGTCTTTGCTTGGCTTTGGTTAAATTAGCAACTTGCTAA ATGAACACAAAACTACTATCGTTCGATTTTGCAACCGAGGAAGAGAGCGAGTTACTGAGCGAACAAGAAAATAAGAACAAGAGGGGGATAAACGTAATGGTATTGGACGATGTTCTAGAAGAAAGAATGGTTTGTTTGAAGAAGTGGAAAATTGGAAGTGGAGAAGTTTACTGTTTGATGACACATTGGAATTCGATGGTTGAAAAAAGGGGATTGAAGAGTGGAGAAGAGATTCAAGTTTGGAGCTTCAGAAAAGATGATGAAGATGAAGCTCATCGTCTTTGCTTGGCTTTGGTTAAATTAGCAACTTGCTAA MNTKLLSFDFATEEESELLSEQENKNKRGINVMVLDDVLEERMVCLKKWKIGSGEVYCLMTHWNSMVEKRGLKSGEEIQVWSFRKDDEDEAHRLCLALVKLATC*
BLAST of Csa5G563790 vs. Swiss-Prot
Match: Y3485_ARATH (Putative B3 domain-containing protein At3g24850 OS=Arabidopsis thaliana GN=At3g24850 PE=3 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 1.0e-08 Identity = 35/86 (40.70%), Postives = 47/86 (54.65%), Query Frame = 1
BLAST of Csa5G563790 vs. Swiss-Prot
Match: Y3518_ARATH (B3 domain-containing protein At3g25182 OS=Arabidopsis thaliana GN=At3g25182 PE=2 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 3.2e-07 Identity = 32/86 (37.21%), Postives = 47/86 (54.65%), Query Frame = 1
BLAST of Csa5G563790 vs. Swiss-Prot
Match: Y5405_ARATH (B3 domain-containing protein At5g24050 OS=Arabidopsis thaliana GN=At5g24050 PE=2 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 3.2e-07 Identity = 33/86 (38.37%), Postives = 47/86 (54.65%), Query Frame = 1
BLAST of Csa5G563790 vs. Swiss-Prot
Match: Y1592_ARATH (B3 domain-containing protein At1g05920 OS=Arabidopsis thaliana GN=At1g05920 PE=2 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 5.5e-07 Identity = 35/98 (35.71%), Postives = 51/98 (52.04%), Query Frame = 1
BLAST of Csa5G563790 vs. Swiss-Prot
Match: Y1593_ARATH (B3 domain-containing protein At1g05930 OS=Arabidopsis thaliana GN=At1g05930 PE=2 SV=2) HSP 1 Score: 53.9 bits (128), Expect = 1.2e-06 Identity = 29/84 (34.52%), Postives = 45/84 (53.57%), Query Frame = 1
BLAST of Csa5G563790 vs. TrEMBL
Match: A0A0A0KPF2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G563790 PE=4 SV=1) HSP 1 Score: 214.9 bits (546), Expect = 4.6e-53 Identity = 104/104 (100.00%), Postives = 104/104 (100.00%), Query Frame = 1
BLAST of Csa5G563790 vs. TrEMBL
Match: A0A0A0KPD7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G550750 PE=4 SV=1) HSP 1 Score: 199.1 bits (505), Expect = 2.6e-48 Identity = 96/104 (92.31%), Postives = 100/104 (96.15%), Query Frame = 1
BLAST of Csa5G563790 vs. TrEMBL
Match: A0A0A0KP87_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G544060 PE=4 SV=1) HSP 1 Score: 197.2 bits (500), Expect = 9.9e-48 Identity = 95/104 (91.35%), Postives = 99/104 (95.19%), Query Frame = 1
BLAST of Csa5G563790 vs. TrEMBL
Match: A0A0A0KSY8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G570420 PE=4 SV=1) HSP 1 Score: 184.9 bits (468), Expect = 5.1e-44 Identity = 88/100 (88.00%), Postives = 93/100 (93.00%), Query Frame = 1
BLAST of Csa5G563790 vs. TrEMBL
Match: A0A0A0KUX9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G570410 PE=4 SV=1) HSP 1 Score: 183.7 bits (465), Expect = 1.1e-43 Identity = 89/100 (89.00%), Postives = 92/100 (92.00%), Query Frame = 1
BLAST of Csa5G563790 vs. TAIR10
Match: AT3G24850.1 (AT3G24850.1 Domain of unknown function (DUF313) ) HSP 1 Score: 60.8 bits (146), Expect = 5.6e-10 Identity = 35/86 (40.70%), Postives = 47/86 (54.65%), Query Frame = 1
BLAST of Csa5G563790 vs. TAIR10
Match: AT5G24050.1 (AT5G24050.1 Domain of unknown function (DUF313) ) HSP 1 Score: 55.8 bits (133), Expect = 1.8e-08 Identity = 33/86 (38.37%), Postives = 47/86 (54.65%), Query Frame = 1
BLAST of Csa5G563790 vs. TAIR10
Match: AT1G05920.1 (AT1G05920.1 Domain of unknown function (DUF313) ) HSP 1 Score: 55.1 bits (131), Expect = 3.1e-08 Identity = 35/98 (35.71%), Postives = 51/98 (52.04%), Query Frame = 1
BLAST of Csa5G563790 vs. TAIR10
Match: AT1G05930.1 (AT1G05930.1 Domain of unknown function (DUF313) ) HSP 1 Score: 53.9 bits (128), Expect = 6.9e-08 Identity = 29/84 (34.52%), Postives = 45/84 (53.57%), Query Frame = 1
BLAST of Csa5G563790 vs. TAIR10
Match: AT2G31720.1 (AT2G31720.1 Domain of unknown function (DUF313) ) HSP 1 Score: 51.2 bits (121), Expect = 4.5e-07 Identity = 27/87 (31.03%), Postives = 45/87 (51.72%), Query Frame = 1
BLAST of Csa5G563790 vs. NCBI nr
Match: gi|700196296|gb|KGN51473.1| (hypothetical protein Csa_5G563790 [Cucumis sativus]) HSP 1 Score: 214.9 bits (546), Expect = 6.6e-53 Identity = 104/104 (100.00%), Postives = 104/104 (100.00%), Query Frame = 1
BLAST of Csa5G563790 vs. NCBI nr
Match: gi|778708611|ref|XP_004142863.2| (PREDICTED: B3 domain-containing protein At2g31420-like, partial [Cucumis sativus]) HSP 1 Score: 214.9 bits (546), Expect = 6.6e-53 Identity = 104/104 (100.00%), Postives = 104/104 (100.00%), Query Frame = 1
BLAST of Csa5G563790 vs. NCBI nr
Match: gi|778708608|ref|XP_011656245.1| (PREDICTED: B3 domain-containing protein At2g31420-like [Cucumis sativus]) HSP 1 Score: 199.1 bits (505), Expect = 3.8e-48 Identity = 96/104 (92.31%), Postives = 100/104 (96.15%), Query Frame = 1
BLAST of Csa5G563790 vs. NCBI nr
Match: gi|778703844|ref|XP_011655441.1| (PREDICTED: B3 domain-containing protein At2g31420-like [Cucumis sativus]) HSP 1 Score: 197.2 bits (500), Expect = 1.4e-47 Identity = 95/104 (91.35%), Postives = 99/104 (95.19%), Query Frame = 1
BLAST of Csa5G563790 vs. NCBI nr
Match: gi|659072862|ref|XP_008467133.1| (PREDICTED: B3 domain-containing protein At2g31420-like [Cucumis melo]) HSP 1 Score: 192.6 bits (488), Expect = 3.5e-46 Identity = 92/104 (88.46%), Postives = 97/104 (93.27%), Query Frame = 1
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|