MELO3C025008 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTTCTAAGTGTAGTCTACACTGTGAGTCCCATCGATATCATACCAGAAGGTAATATATATATATATATATAGATATAGATATATTTTTCGACCCAGATACCTGTTTGTACTTTCTGTTGGTTTATTGGTTTCTTATGAATTTGTTTTTTCTGGCTCGACTGTTTATGTGCAGCATTACTAGGATTATTTGGACTGATGGATGATATCCTTATACTGCTCATCTGCTTCCTTTACATTGCTGCTATGTACCGATCAGTACTTTATAATCGTCACGGAGGAACTTGA ATGGTTCTAAGTGTAGTCTACACTGTGAGTCCCATCGATATCATACCAGAAGCATTACTAGGATTATTTGGACTGATGGATGATATCCTTATACTGCTCATCTGCTTCCTTTACATTGCTGCTATGTACCGATCAGTACTTTATAATCGTCACGGAGGAACTTGA ATGGTTCTAAGTGTAGTCTACACTGTGAGTCCCATCGATATCATACCAGAAGCATTACTAGGATTATTTGGACTGATGGATGATATCCTTATACTGCTCATCTGCTTCCTTTACATTGCTGCTATGTACCGATCAGTACTTTATAATCGTCACGGAGGAACTTGA MVLSVVYTVSPIDIIPEALLGLFGLMDDILILLICFLYIAAMYRSVLYNRHGGT*
BLAST of MELO3C025008 vs. Swiss-Prot
Match: RN170_DANRE (E3 ubiquitin-protein ligase RNF170 OS=Danio rerio GN=rnf170 PE=2 SV=1) HSP 1 Score: 57.4 bits (137), Expect = 5.8e-08 Identity = 23/50 (46.00%), Postives = 33/50 (66.00%), Query Frame = 1
BLAST of MELO3C025008 vs. Swiss-Prot
Match: RN170_XENLA (E3 ubiquitin-protein ligase RNF170 OS=Xenopus laevis GN=rnf170 PE=2 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 7.5e-08 Identity = 23/47 (48.94%), Postives = 33/47 (70.21%), Query Frame = 1
BLAST of MELO3C025008 vs. Swiss-Prot
Match: RN170_XENTR (E3 ubiquitin-protein ligase RNF170 OS=Xenopus tropicalis GN=rnf170 PE=2 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 2.9e-07 Identity = 23/47 (48.94%), Postives = 31/47 (65.96%), Query Frame = 1
BLAST of MELO3C025008 vs. Swiss-Prot
Match: RN170_BOVIN (E3 ubiquitin-protein ligase RNF170 OS=Bos taurus GN=RNF170 PE=3 SV=2) HSP 1 Score: 52.4 bits (124), Expect = 1.9e-06 Identity = 19/44 (43.18%), Postives = 28/44 (63.64%), Query Frame = 1
BLAST of MELO3C025008 vs. Swiss-Prot
Match: RN170_HUMAN (E3 ubiquitin-protein ligase RNF170 OS=Homo sapiens GN=RNF170 PE=1 SV=2) HSP 1 Score: 52.4 bits (124), Expect = 1.9e-06 Identity = 19/44 (43.18%), Postives = 28/44 (63.64%), Query Frame = 1
BLAST of MELO3C025008 vs. TrEMBL
Match: U5FS44_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0013s11010g PE=4 SV=1) HSP 1 Score: 87.0 bits (214), Expect = 7.6e-15 Identity = 38/54 (70.37%), Postives = 49/54 (90.74%), Query Frame = 1
BLAST of MELO3C025008 vs. TrEMBL
Match: A0A067GW82_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g029826mg PE=4 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 9.9e-15 Identity = 38/53 (71.70%), Postives = 47/53 (88.68%), Query Frame = 1
BLAST of MELO3C025008 vs. TrEMBL
Match: V4T8S4_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10002598mg PE=4 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 9.9e-15 Identity = 38/53 (71.70%), Postives = 47/53 (88.68%), Query Frame = 1
BLAST of MELO3C025008 vs. TrEMBL
Match: A0A067H8R0_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g029826mg PE=4 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 9.9e-15 Identity = 38/53 (71.70%), Postives = 47/53 (88.68%), Query Frame = 1
BLAST of MELO3C025008 vs. TrEMBL
Match: Q8LDL6_ARATH (Putative uncharacterized protein OS=Arabidopsis thaliana GN=At1g22510 PE=2 SV=1) HSP 1 Score: 85.9 bits (211), Expect = 1.7e-14 Identity = 36/54 (66.67%), Postives = 49/54 (90.74%), Query Frame = 1
BLAST of MELO3C025008 vs. TAIR10
Match: AT1G22510.2 (AT1G22510.2 RING/U-box protein with domain of unknown function (DUF 1232)) HSP 1 Score: 85.9 bits (211), Expect = 8.5e-18 Identity = 36/54 (66.67%), Postives = 47/54 (87.04%), Query Frame = 1
BLAST of MELO3C025008 vs. TAIR10
Match: AT1G72175.1 (AT1G72175.1 RING/U-box protein with domain of unknown function (DUF 1232)) HSP 1 Score: 83.2 bits (204), Expect = 5.5e-17 Identity = 37/54 (68.52%), Postives = 45/54 (83.33%), Query Frame = 1
BLAST of MELO3C025008 vs. NCBI nr
Match: gi|659126217|ref|XP_008463070.1| (PREDICTED: E3 ubiquitin-protein ligase RNF170-like [Cucumis melo]) HSP 1 Score: 109.0 bits (271), Expect = 2.7e-21 Identity = 54/54 (100.00%), Postives = 54/54 (100.00%), Query Frame = 1
BLAST of MELO3C025008 vs. NCBI nr
Match: gi|449441207|ref|XP_004138374.1| (PREDICTED: E3 ubiquitin-protein ligase RNF170-like [Cucumis sativus]) HSP 1 Score: 108.6 bits (270), Expect = 3.5e-21 Identity = 53/54 (98.15%), Postives = 54/54 (100.00%), Query Frame = 1
BLAST of MELO3C025008 vs. NCBI nr
Match: gi|1012179668|ref|XP_015967830.1| (PREDICTED: E3 ubiquitin-protein ligase RNF170 [Arachis duranensis]) HSP 1 Score: 88.6 bits (218), Expect = 3.7e-15 Identity = 39/54 (72.22%), Postives = 50/54 (92.59%), Query Frame = 1
BLAST of MELO3C025008 vs. NCBI nr
Match: gi|1021522408|ref|XP_016204594.1| (PREDICTED: E3 ubiquitin-protein ligase RNF170 [Arachis ipaensis]) HSP 1 Score: 88.6 bits (218), Expect = 3.7e-15 Identity = 39/54 (72.22%), Postives = 50/54 (92.59%), Query Frame = 1
BLAST of MELO3C025008 vs. NCBI nr
Match: gi|727608758|ref|XP_010477510.1| (PREDICTED: E3 ubiquitin-protein ligase RNF170 [Camelina sativa]) HSP 1 Score: 87.8 bits (216), Expect = 6.4e-15 Identity = 38/54 (70.37%), Postives = 48/54 (88.89%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|