MELO3C020592 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ACAATGAAAATGGAAACCCACATGACATTTTATTGGGGAAAGACGGTGGAGATCCTCTTCGTCGGCTGGCCCGGTCGGAGCTTTTTCTCTTACACCGTTGCTTTAATCTTTGTTTTTCTTCTCGCCTTCACCGTGGAGTGGCTCTCACACACTAAATTCACCACTCTCGTCGTTGGCAACCTCACTGCCGGCCTGGTTCAGACCATCCTATACGGTGTTCGGGTGGGATTGGCTTTCATTGTCATGCTGGCCGTCATGTCATATAATGTTGGAGTTTTGCTAGCGGCAGTAACTGGATATTCAATGGGGTTCTTGGTTTATGGGAGTCAAGTATTTAGTAGATCGAAAGTTGATCAAAATTTAAATTTAGATTTGTCTGATCTTCCACCACTTAATTGTTAGTACCATGACAAACCTCAATATTTTATGAAAGA ACAATGAAAATGGAAACCCACATGACATTTTATTGGGGAAAGACGGTGGAGATCCTCTTCGTCGGCTGGCCCGGTCGGAGCTTTTTCTCTTACACCGTTGCTTTAATCTTTGTTTTTCTTCTCGCCTTCACCGTGGAGTGGCTCTCACACACTAAATTCACCACTCTCGTCGTTGGCAACCTCACTGCCGGCCTGGTTCAGACCATCCTATACGGTGTTCGGGTGGGATTGGCTTTCATTGTCATGCTGGCCGTCATGTCATATAATGTTGGAGTTTTGCTAGCGGCAGTAACTGGATATTCAATGGGGTTCTTGGTTTATGGGAGTCAAGTATTTAGTAGATCGAAAGTTGATCAAAATTTAAATTTAGATTTGTCTGATCTTCCACCACTTAATTGTTAGTACCATGACAAACCTCAATATTTTATGAAAGA ATGAAAATGGAAACCCACATGACATTTTATTGGGGAAAGACGGTGGAGATCCTCTTCGTCGGCTGGCCCGGTCGGAGCTTTTTCTCTTACACCGTTGCTTTAATCTTTGTTTTTCTTCTCGCCTTCACCGTGGAGTGGCTCTCACACACTAAATTCACCACTCTCGTCGTTGGCAACCTCACTGCCGGCCTGGTTCAGACCATCCTATACGGTGTTCGGGTGGGATTGGCTTTCATTGTCATGCTGGCCGTCATGTCATATAATGTTGGAGTTTTGCTAGCGGCAGTAACTGGATATTCAATGGGGTTCTTGGTTTATGGGAGTCAAGTATTTAGTAGATCGAAAGTTGATCAAAATTTAAATTTAGATTTGTCTGATCTTCCACCACTTAATTGTTAG MKMETHMTFYWGKTVEILFVGWPGRSFFSYTVALIFVFLLAFTVEWLSHTKFTTLVVGNLTAGLVQTILYGVRVGLAFIVMLAVMSYNVGVLLAAVTGYSMGFLVYGSQVFSRSKVDQNLNLDLSDLPPLNC*
BLAST of MELO3C020592 vs. Swiss-Prot
Match: COPT1_ARATH (Copper transporter 1 OS=Arabidopsis thaliana GN=COPT1 PE=2 SV=2) HSP 1 Score: 136.3 bits (342), Expect = 2.4e-31 Identity = 66/135 (48.89%), Postives = 86/135 (63.70%), Query Frame = 1
BLAST of MELO3C020592 vs. Swiss-Prot
Match: COPT2_ARATH (Copper transporter 2 OS=Arabidopsis thaliana GN=COPT2 PE=2 SV=1) HSP 1 Score: 121.3 bits (303), Expect = 7.9e-27 Identity = 56/117 (47.86%), Postives = 74/117 (63.25%), Query Frame = 1
BLAST of MELO3C020592 vs. Swiss-Prot
Match: COPT6_ARATH (Copper transporter 6 OS=Arabidopsis thaliana GN=COPT6 PE=2 SV=1) HSP 1 Score: 118.2 bits (295), Expect = 6.7e-26 Identity = 57/114 (50.00%), Postives = 74/114 (64.91%), Query Frame = 1
BLAST of MELO3C020592 vs. Swiss-Prot
Match: COPT3_ARATH (Copper transporter 3 OS=Arabidopsis thaliana GN=COPT3 PE=2 SV=1) HSP 1 Score: 109.8 bits (273), Expect = 2.4e-23 Identity = 51/106 (48.11%), Postives = 70/106 (66.04%), Query Frame = 1
BLAST of MELO3C020592 vs. Swiss-Prot
Match: COPT3_ORYSJ (Copper transporter 3 OS=Oryza sativa subsp. japonica GN=COPT3 PE=2 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 2.5e-20 Identity = 52/106 (49.06%), Postives = 67/106 (63.21%), Query Frame = 1
BLAST of MELO3C020592 vs. TrEMBL
Match: A0A0A0LXH5_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G526835 PE=4 SV=1) HSP 1 Score: 231.9 bits (590), Expect = 4.6e-58 Identity = 110/130 (84.62%), Postives = 120/130 (92.31%), Query Frame = 1
BLAST of MELO3C020592 vs. TrEMBL
Match: V4SMC6_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10029961mg PE=4 SV=1) HSP 1 Score: 164.9 bits (416), Expect = 6.9e-38 Identity = 76/130 (58.46%), Postives = 100/130 (76.92%), Query Frame = 1
BLAST of MELO3C020592 vs. TrEMBL
Match: A0A067FKS2_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g033054mg PE=4 SV=1) HSP 1 Score: 164.5 bits (415), Expect = 9.0e-38 Identity = 75/127 (59.06%), Postives = 99/127 (77.95%), Query Frame = 1
BLAST of MELO3C020592 vs. TrEMBL
Match: V4UFW1_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10030036mg PE=4 SV=1) HSP 1 Score: 162.2 bits (409), Expect = 4.5e-37 Identity = 74/130 (56.92%), Postives = 99/130 (76.15%), Query Frame = 1
BLAST of MELO3C020592 vs. TrEMBL
Match: E9LK44_VITVI (Copper transporter OS=Vitis vinifera GN=CTr7 PE=2 SV=1) HSP 1 Score: 152.5 bits (384), Expect = 3.6e-34 Identity = 75/130 (57.69%), Postives = 92/130 (70.77%), Query Frame = 1
BLAST of MELO3C020592 vs. TAIR10
Match: AT5G59030.1 (AT5G59030.1 copper transporter 1) HSP 1 Score: 136.3 bits (342), Expect = 1.3e-32 Identity = 66/135 (48.89%), Postives = 86/135 (63.70%), Query Frame = 1
BLAST of MELO3C020592 vs. TAIR10
Match: AT3G46900.1 (AT3G46900.1 copper transporter 2) HSP 1 Score: 121.3 bits (303), Expect = 4.4e-28 Identity = 56/117 (47.86%), Postives = 74/117 (63.25%), Query Frame = 1
BLAST of MELO3C020592 vs. TAIR10
Match: AT2G26975.1 (AT2G26975.1 Ctr copper transporter family) HSP 1 Score: 118.2 bits (295), Expect = 3.8e-27 Identity = 57/114 (50.00%), Postives = 74/114 (64.91%), Query Frame = 1
BLAST of MELO3C020592 vs. TAIR10
Match: AT5G59040.1 (AT5G59040.1 copper transporter 3) HSP 1 Score: 109.8 bits (273), Expect = 1.3e-24 Identity = 51/106 (48.11%), Postives = 70/106 (66.04%), Query Frame = 1
BLAST of MELO3C020592 vs. TAIR10
Match: AT2G37925.1 (AT2G37925.1 copper transporter 4) HSP 1 Score: 95.9 bits (237), Expect = 2.0e-20 Identity = 46/109 (42.20%), Postives = 65/109 (59.63%), Query Frame = 1
BLAST of MELO3C020592 vs. NCBI nr
Match: gi|659115177|ref|XP_008457426.1| (PREDICTED: copper transporter 1-like [Cucumis melo]) HSP 1 Score: 266.2 bits (679), Expect = 3.2e-68 Identity = 132/132 (100.00%), Postives = 132/132 (100.00%), Query Frame = 1
BLAST of MELO3C020592 vs. NCBI nr
Match: gi|700210668|gb|KGN65764.1| (hypothetical protein Csa_1G526835 [Cucumis sativus]) HSP 1 Score: 231.9 bits (590), Expect = 6.6e-58 Identity = 110/130 (84.62%), Postives = 120/130 (92.31%), Query Frame = 1
BLAST of MELO3C020592 vs. NCBI nr
Match: gi|567864624|ref|XP_006424961.1| (hypothetical protein CICLE_v10029961mg [Citrus clementina]) HSP 1 Score: 164.9 bits (416), Expect = 9.9e-38 Identity = 76/130 (58.46%), Postives = 100/130 (76.92%), Query Frame = 1
BLAST of MELO3C020592 vs. NCBI nr
Match: gi|985462900|ref|XP_015388805.1| (PREDICTED: copper transporter 1-like [Citrus sinensis]) HSP 1 Score: 164.5 bits (415), Expect = 1.3e-37 Identity = 75/127 (59.06%), Postives = 99/127 (77.95%), Query Frame = 1
BLAST of MELO3C020592 vs. NCBI nr
Match: gi|567864630|ref|XP_006424964.1| (hypothetical protein CICLE_v10030036mg [Citrus clementina]) HSP 1 Score: 162.2 bits (409), Expect = 6.4e-37 Identity = 74/130 (56.92%), Postives = 99/130 (76.15%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|