MELO3C019444 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTGAGTGAGTTCTACCATTCTTTTGTTCCTTTTTTTTTTTTAAAAAGATATTATTAGAATATAAAATCTTAATCGATTTGTTGCTTATTTTAGGTGAGTTACTGTGAAAATGATGTTGATTGCCGGCGTTTGCTGCAACTTGTCCATTTTGGGGAGAAGTTTGATCCTGGAAAAAATTGCAAGAAAACATGTGATAATTGTTTGAAGTCCACAAATCTTATAGAAAAGGATGTCAGTGATGTCACTAAGCAACTGGTCTGGTGCAAAATTTTGCAATGTTCTGTTAAACTTATTCTATTATAG ATGGTGAGTTACTGTGAAAATGATGTTGATTGCCGGCGTTTGCTGCAACTTGTCCATTTTGGGGAGAAGTTTGATCCTGGAAAAAATTGCAAGAAAACATGTGATAATTGTTTGAAGTCCACAAATCTTATAGAAAAGGATGTCAGTGATGTCACTAAGCAACTGGTCTGGTGCAAAATTTTGCAATGTTCTGTTAAACTTATTCTATTATAG ATGGTGAGTTACTGTGAAAATGATGTTGATTGCCGGCGTTTGCTGCAACTTGTCCATTTTGGGGAGAAGTTTGATCCTGGAAAAAATTGCAAGAAAACATGTGATAATTGTTTGAAGTCCACAAATCTTATAGAAAAGGATGTCAGTGATGTCACTAAGCAACTGGTCTGGTGCAAAATTTTGCAATGTTCTGTTAAACTTATTCTATTATAG MVSYCENDVDCRRLLQLVHFGEKFDPGKNCKKTCDNCLKSTNLIEKDVSDVTKQLVWCKILQCSVKLILL*
BLAST of MELO3C019444 vs. Swiss-Prot
Match: RQL4A_ARATH (ATP-dependent DNA helicase Q-like 4A OS=Arabidopsis thaliana GN=RECQL4A PE=2 SV=1) HSP 1 Score: 85.5 bits (210), Expect = 2.6e-16 Identity = 39/56 (69.64%), Postives = 44/56 (78.57%), Query Frame = 1
BLAST of MELO3C019444 vs. Swiss-Prot
Match: RQL4B_ARATH (ATP-dependent DNA helicase Q-like 4B OS=Arabidopsis thaliana GN=RECQL4B PE=2 SV=1) HSP 1 Score: 83.6 bits (205), Expect = 9.7e-16 Identity = 39/56 (69.64%), Postives = 42/56 (75.00%), Query Frame = 1
BLAST of MELO3C019444 vs. Swiss-Prot
Match: SGS1_YEAST (ATP-dependent helicase SGS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGS1 PE=1 SV=1) HSP 1 Score: 57.8 bits (138), Expect = 5.7e-08 Identity = 28/58 (48.28%), Postives = 37/58 (63.79%), Query Frame = 1
BLAST of MELO3C019444 vs. Swiss-Prot
Match: RECQ1_PONAB (ATP-dependent DNA helicase Q1 OS=Pongo abelii GN=RECQL PE=2 SV=1) HSP 1 Score: 52.4 bits (124), Expect = 2.4e-06 Identity = 27/67 (40.30%), Postives = 39/67 (58.21%), Query Frame = 1
BLAST of MELO3C019444 vs. Swiss-Prot
Match: RECQ1_HUMAN (ATP-dependent DNA helicase Q1 OS=Homo sapiens GN=RECQL PE=1 SV=3) HSP 1 Score: 51.2 bits (121), Expect = 5.3e-06 Identity = 26/67 (38.81%), Postives = 39/67 (58.21%), Query Frame = 1
BLAST of MELO3C019444 vs. TrEMBL
Match: A0A0A0L762_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G221760 PE=4 SV=1) HSP 1 Score: 112.5 bits (280), Expect = 2.2e-22 Identity = 52/56 (92.86%), Postives = 55/56 (98.21%), Query Frame = 1
BLAST of MELO3C019444 vs. TrEMBL
Match: W1NSM6_AMBTC (Uncharacterized protein OS=Amborella trichopoda GN=AMTR_s00118p00027960 PE=4 SV=1) HSP 1 Score: 95.1 bits (235), Expect = 3.6e-17 Identity = 43/56 (76.79%), Postives = 48/56 (85.71%), Query Frame = 1
BLAST of MELO3C019444 vs. TrEMBL
Match: A0A0L9VHB1_PHAAN (Uncharacterized protein OS=Phaseolus angularis GN=LR48_Vigan09g273300 PE=4 SV=1) HSP 1 Score: 95.1 bits (235), Expect = 3.6e-17 Identity = 44/56 (78.57%), Postives = 48/56 (85.71%), Query Frame = 1
BLAST of MELO3C019444 vs. TrEMBL
Match: G7INR2_MEDTR (ATP-dependent DNA helicase RecQ family protein OS=Medicago truncatula GN=MTR_2g006440 PE=4 SV=2) HSP 1 Score: 95.1 bits (235), Expect = 3.6e-17 Identity = 42/56 (75.00%), Postives = 49/56 (87.50%), Query Frame = 1
BLAST of MELO3C019444 vs. TrEMBL
Match: V7BRA0_PHAVU (Uncharacterized protein OS=Phaseolus vulgaris GN=PHAVU_006G216200g PE=4 SV=1) HSP 1 Score: 95.1 bits (235), Expect = 3.6e-17 Identity = 44/56 (78.57%), Postives = 48/56 (85.71%), Query Frame = 1
BLAST of MELO3C019444 vs. TAIR10
Match: AT1G10930.1 (AT1G10930.1 DNA helicase (RECQl4A)) HSP 1 Score: 85.5 bits (210), Expect = 1.4e-17 Identity = 39/56 (69.64%), Postives = 44/56 (78.57%), Query Frame = 1
BLAST of MELO3C019444 vs. TAIR10
Match: AT1G60930.1 (AT1G60930.1 RECQ helicase L4B) HSP 1 Score: 83.6 bits (205), Expect = 5.5e-17 Identity = 39/56 (69.64%), Postives = 42/56 (75.00%), Query Frame = 1
BLAST of MELO3C019444 vs. TAIR10
Match: AT1G31360.1 (AT1G31360.1 RECQ helicase L2) HSP 1 Score: 50.8 bits (120), Expect = 3.9e-07 Identity = 24/56 (42.86%), Postives = 33/56 (58.93%), Query Frame = 1
BLAST of MELO3C019444 vs. NCBI nr
Match: gi|778680266|ref|XP_011651280.1| (PREDICTED: ATP-dependent DNA helicase Q-like 4A isoform X1 [Cucumis sativus]) HSP 1 Score: 112.5 bits (280), Expect = 3.1e-22 Identity = 52/56 (92.86%), Postives = 55/56 (98.21%), Query Frame = 1
BLAST of MELO3C019444 vs. NCBI nr
Match: gi|700202460|gb|KGN57593.1| (hypothetical protein Csa_3G221760 [Cucumis sativus]) HSP 1 Score: 112.5 bits (280), Expect = 3.1e-22 Identity = 52/56 (92.86%), Postives = 55/56 (98.21%), Query Frame = 1
BLAST of MELO3C019444 vs. NCBI nr
Match: gi|659112086|ref|XP_008456059.1| (PREDICTED: ATP-dependent DNA helicase Q-like 4A isoform X2 [Cucumis melo]) HSP 1 Score: 109.8 bits (273), Expect = 2.0e-21 Identity = 51/56 (91.07%), Postives = 53/56 (94.64%), Query Frame = 1
BLAST of MELO3C019444 vs. NCBI nr
Match: gi|659112088|ref|XP_008456060.1| (PREDICTED: ATP-dependent DNA helicase Q-like 4A isoform X3 [Cucumis melo]) HSP 1 Score: 109.8 bits (273), Expect = 2.0e-21 Identity = 51/56 (91.07%), Postives = 53/56 (94.64%), Query Frame = 1
BLAST of MELO3C019444 vs. NCBI nr
Match: gi|659112090|ref|XP_008456061.1| (PREDICTED: ATP-dependent DNA helicase Q-like 4A isoform X4 [Cucumis melo]) HSP 1 Score: 109.8 bits (273), Expect = 2.0e-21 Identity = 51/56 (91.07%), Postives = 53/56 (94.64%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|