MELO3C019421 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.GTCTGCGACAGTTGATTCAAACCTTTTCTCAGGATACTTTGGTAACTGCCCTGTAATCACTGCAGAGGGTAGGGTGCATCCTGTAACCACCTACTTTCTTGAAGATATATATGAGAGTACTGGGTACCACCTCGCTTCAGACTCCCCTGCTGCCATACGATATGAAGTATCAAGTGGCAAAAAGGTATCTGGAACTCGTTTCCTACTCTATTAA GTCTGCGACAGTTGATTCAAACCTTTTCTCAGGATACTTTGGTAACTGCCCTGTAATCACTGCAGAGGGTAGGGTGCATCCTGTAACCACCTACTTTCTTGAAGATATATATGAGAGTACTGGGTACCACCTCGCTTCAGACTCCCCTGCTGCCATACGATATGAAGTATCAAGTGGCAAAAAGGTATCTGGAACTCGTTTCCTACTCTATTAA GTCTGCGACAGTTGATTCAAACCTTTTCTCAGGATACTTTGGTAACTGCCCTGTAATCACTGCAGAGGGTAGGGTGCATCCTGTAACCACCTACTTTCTTGAAGATATATATGAGAGTACTGGGTACCACCTCGCTTCAGACTCCCCTGCTGCCATACGATATGAAGTATCAAGTGGCAAAAAGGTATCTGGAACTCGTTTCCTACTCTATTAA SATVDSNLFSGYFGNCPVITAEGRVHPVTTYFLEDIYESTGYHLASDSPAAIRYEVSSGKKVSGTRFLLY*
BLAST of MELO3C019421 vs. Swiss-Prot
Match: DEXH7_ARATH (DExH-box ATP-dependent RNA helicase DExH7, chloroplastic OS=Arabidopsis thaliana GN=At1g58060 PE=2 SV=1) HSP 1 Score: 88.6 bits (218), Expect = 3.0e-17 Identity = 42/62 (67.74%), Postives = 49/62 (79.03%), Query Frame = 1
BLAST of MELO3C019421 vs. Swiss-Prot
Match: DEXH4_ARATH (DExH-box ATP-dependent RNA helicase DExH4, chloroplastic OS=Arabidopsis thaliana GN=At1g58050 PE=3 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 3.9e-17 Identity = 42/62 (67.74%), Postives = 47/62 (75.81%), Query Frame = 1
BLAST of MELO3C019421 vs. Swiss-Prot
Match: DHX29_MOUSE (ATP-dependent RNA helicase Dhx29 OS=Mus musculus GN=Dhx29 PE=1 SV=1) HSP 1 Score: 56.6 bits (135), Expect = 1.3e-07 Identity = 26/48 (54.17%), Postives = 31/48 (64.58%), Query Frame = 1
BLAST of MELO3C019421 vs. Swiss-Prot
Match: DHX29_HUMAN (ATP-dependent RNA helicase DHX29 OS=Homo sapiens GN=DHX29 PE=1 SV=2) HSP 1 Score: 56.2 bits (134), Expect = 1.7e-07 Identity = 26/48 (54.17%), Postives = 30/48 (62.50%), Query Frame = 1
BLAST of MELO3C019421 vs. Swiss-Prot
Match: DHX57_HUMAN (Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens GN=DHX57 PE=1 SV=2) HSP 1 Score: 54.7 bits (130), Expect = 4.8e-07 Identity = 29/66 (43.94%), Postives = 35/66 (53.03%), Query Frame = 1
BLAST of MELO3C019421 vs. TrEMBL
Match: A0A0A0L6M0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G228870 PE=4 SV=1) HSP 1 Score: 135.2 bits (339), Expect = 3.1e-29 Identity = 65/70 (92.86%), Postives = 67/70 (95.71%), Query Frame = 1
BLAST of MELO3C019421 vs. TrEMBL
Match: V4T5X0_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v100000301mg PE=4 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 1.1e-18 Identity = 48/58 (82.76%), Postives = 50/58 (86.21%), Query Frame = 1
BLAST of MELO3C019421 vs. TrEMBL
Match: A0A067DYB2_CITSI (Uncharacterized protein (Fragment) OS=Citrus sinensis GN=CISIN_1g0472022mg PE=4 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 1.1e-18 Identity = 48/58 (82.76%), Postives = 50/58 (86.21%), Query Frame = 1
BLAST of MELO3C019421 vs. TrEMBL
Match: V4SVZ1_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v100000301mg PE=4 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 1.1e-18 Identity = 48/58 (82.76%), Postives = 50/58 (86.21%), Query Frame = 1
BLAST of MELO3C019421 vs. TrEMBL
Match: V4SBK4_9ROSI (Uncharacterized protein (Fragment) OS=Citrus clementina GN=CICLE_v100000301mg PE=4 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 1.1e-18 Identity = 48/58 (82.76%), Postives = 50/58 (86.21%), Query Frame = 1
BLAST of MELO3C019421 vs. TAIR10
Match: AT1G58060.1 (AT1G58060.1 RNA helicase family protein) HSP 1 Score: 88.6 bits (218), Expect = 1.7e-18 Identity = 42/62 (67.74%), Postives = 49/62 (79.03%), Query Frame = 1
BLAST of MELO3C019421 vs. TAIR10
Match: AT1G58050.1 (AT1G58050.1 RNA helicase family protein) HSP 1 Score: 88.2 bits (217), Expect = 2.2e-18 Identity = 42/62 (67.74%), Postives = 47/62 (75.81%), Query Frame = 1
BLAST of MELO3C019421 vs. TAIR10
Match: AT5G04895.1 (AT5G04895.1 DEA(D/H)-box RNA helicase family protein) HSP 1 Score: 53.5 bits (127), Expect = 6.1e-08 Identity = 24/46 (52.17%), Postives = 28/46 (60.87%), Query Frame = 1
BLAST of MELO3C019421 vs. TAIR10
Match: AT2G01130.1 (AT2G01130.1 DEA(D/H)-box RNA helicase family protein) HSP 1 Score: 49.3 bits (116), Expect = 1.1e-06 Identity = 24/44 (54.55%), Postives = 27/44 (61.36%), Query Frame = 1
BLAST of MELO3C019421 vs. TAIR10
Match: AT2G30800.1 (AT2G30800.1 helicase in vascular tissue and tapetum) HSP 1 Score: 48.9 bits (115), Expect = 1.5e-06 Identity = 20/36 (55.56%), Postives = 24/36 (66.67%), Query Frame = 1
BLAST of MELO3C019421 vs. NCBI nr
Match: gi|700202477|gb|KGN57610.1| (hypothetical protein Csa_3G228870 [Cucumis sativus]) HSP 1 Score: 135.2 bits (339), Expect = 4.5e-29 Identity = 65/70 (92.86%), Postives = 67/70 (95.71%), Query Frame = 1
BLAST of MELO3C019421 vs. NCBI nr
Match: gi|659112042|ref|XP_008456037.1| (PREDICTED: ATP-dependent RNA helicase DHX36 isoform X2 [Cucumis melo]) HSP 1 Score: 127.9 bits (320), Expect = 7.2e-27 Identity = 61/61 (100.00%), Postives = 61/61 (100.00%), Query Frame = 1
BLAST of MELO3C019421 vs. NCBI nr
Match: gi|659112040|ref|XP_008456036.1| (PREDICTED: ATP-dependent RNA helicase DHX29 isoform X1 [Cucumis melo]) HSP 1 Score: 127.9 bits (320), Expect = 7.2e-27 Identity = 61/61 (100.00%), Postives = 61/61 (100.00%), Query Frame = 1
BLAST of MELO3C019421 vs. NCBI nr
Match: gi|778680313|ref|XP_011651287.1| (PREDICTED: ATP-dependent RNA helicase DHX29 isoform X1 [Cucumis sativus]) HSP 1 Score: 126.3 bits (316), Expect = 2.1e-26 Identity = 59/61 (96.72%), Postives = 61/61 (100.00%), Query Frame = 1
BLAST of MELO3C019421 vs. NCBI nr
Match: gi|778680315|ref|XP_011651288.1| (PREDICTED: ATP-dependent RNA helicase DHX36 isoform X2 [Cucumis sativus]) HSP 1 Score: 126.3 bits (316), Expect = 2.1e-26 Identity = 59/61 (96.72%), Postives = 61/61 (100.00%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|