MELO3C018771.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTGGTGAGCAACAACAGTATACTAACTTCAATTCTAATTCCTCCATCAAAACTAACTTCTCTGTTTATCCTAATCATACTTCTAGTAAGTGTTCTTCTTCTTCCAAGTATCCCACCAAATTTTCTCACAATGGCTCCATCTCTCAGGGTGAGAAAGATAAGATAAAAAAGGCTGAAGAGTCTCTTCGAACCGTCATGTATTTGAGTTGTTGGGGCCCCAATTCATGA ATGGCTGGTGAGCAACAACAGTATACTAACTTCAATTCTAATTCCTCCATCAAAACTAACTTCTCTGTTTATCCTAATCATACTTCTAGTAAGTGTTCTTCTTCTTCCAAGTATCCCACCAAATTTTCTCACAATGGCTCCATCTCTCAGGGTGAGAAAGATAAGATAAAAAAGGCTGAAGAGTCTCTTCGAACCGTCATGTATTTGAGTTGTTGGGGCCCCAATTCATGA ATGGCTGGTGAGCAACAACAGTATACTAACTTCAATTCTAATTCCTCCATCAAAACTAACTTCTCTGTTTATCCTAATCATACTTCTAGTAAGTGTTCTTCTTCTTCCAAGTATCCCACCAAATTTTCTCACAATGGCTCCATCTCTCAGGGTGAGAAAGATAAGATAAAAAAGGCTGAAGAGTCTCTTCGAACCGTCATGTATTTGAGTTGTTGGGGCCCCAATTCATGA MAGEQQQYTNFNSNSSIKTNFSVYPNHTSSKCSSSSKYPTKFSHNGSISQGEKDKIKKAEESLRTVMYLSCWGPNS
BLAST of MELO3C018771.2 vs. NCBI nr
Match: KGN43575.1 (hypothetical protein Csa_7G046140 [Cucumis sativus]) HSP 1 Score: 137.5 bits (345), Expect = 1.9e-29 Identity = 72/78 (92.31%), Postives = 74/78 (94.87%), Query Frame = 0
BLAST of MELO3C018771.2 vs. NCBI nr
Match: XP_019090384.1 (PREDICTED: uncharacterized protein LOC109128467 [Camelina sativa]) HSP 1 Score: 54.3 bits (129), Expect = 2.1e-04 Identity = 26/45 (57.78%), Postives = 30/45 (66.67%), Query Frame = 0
BLAST of MELO3C018771.2 vs. NCBI nr
Match: XP_002872503.1 (uncharacterized protein LOC9310684 [Arabidopsis lyrata subsp. lyrata] >EFH48762.1 predicted protein [Arabidopsis lyrata subsp. lyrata]) HSP 1 Score: 53.5 bits (127), Expect = 3.6e-04 Identity = 23/27 (85.19%), Postives = 24/27 (88.89%), Query Frame = 0
BLAST of MELO3C018771.2 vs. NCBI nr
Match: KDP20875.1 (hypothetical protein JCGZ_21346 [Jatropha curcas]) HSP 1 Score: 53.5 bits (127), Expect = 3.6e-04 Identity = 28/47 (59.57%), Postives = 33/47 (70.21%), Query Frame = 0
BLAST of MELO3C018771.2 vs. NCBI nr
Match: NP_192765.1 (Wound-responsive family protein [Arabidopsis thaliana] >AAC62808.1 contains similarity to Solanum lycopersicum (tomato) wound-induced protein (GB:X59882) [Arabidopsis thaliana] >CAB39780.1 probable wound-induced protein [Arabidopsis thaliana] >CAB78150.1 probable wound-induced protein [Arabidopsis thaliana] >AAM63015.1 probable wound-induced protein [Arabidopsis thaliana] >ABE02398.1 At4g10270 [Arabidopsis thaliana] >AEE82862.1 Wound-responsive family protein [Arabidopsis thaliana]) HSP 1 Score: 53.5 bits (127), Expect = 3.6e-04 Identity = 23/27 (85.19%), Postives = 24/27 (88.89%), Query Frame = 0
BLAST of MELO3C018771.2 vs. TAIR10
Match: AT4G10270.1 (Wound-responsive family protein) HSP 1 Score: 53.5 bits (127), Expect = 6.5e-08 Identity = 23/27 (85.19%), Postives = 24/27 (88.89%), Query Frame = 0
BLAST of MELO3C018771.2 vs. TAIR10
Match: AT4G10265.1 (Wound-responsive family protein) HSP 1 Score: 44.7 bits (104), Expect = 3.0e-05 Identity = 22/38 (57.89%), Postives = 27/38 (71.05%), Query Frame = 0
BLAST of MELO3C018771.2 vs. TrEMBL
Match: tr|A0A0A0K1Q2|A0A0A0K1Q2_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G046140 PE=4 SV=1) HSP 1 Score: 137.5 bits (345), Expect = 1.2e-29 Identity = 72/78 (92.31%), Postives = 74/78 (94.87%), Query Frame = 0
BLAST of MELO3C018771.2 vs. TrEMBL
Match: tr|O82615|O82615_ARATH (At4g10270 OS=Arabidopsis thaliana OX=3702 GN=F24G24.70 PE=2 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 2.4e-04 Identity = 23/27 (85.19%), Postives = 24/27 (88.89%), Query Frame = 0
BLAST of MELO3C018771.2 vs. TrEMBL
Match: tr|A0A1J3HJC3|A0A1J3HJC3_NOCCA (Uncharacterized protein OS=Noccaea caerulescens OX=107243 GN=LC_TR9554_c0_g1_i1_g.33883 PE=4 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 2.4e-04 Identity = 23/27 (85.19%), Postives = 24/27 (88.89%), Query Frame = 0
BLAST of MELO3C018771.2 vs. TrEMBL
Match: tr|A0A1J3DBQ0|A0A1J3DBQ0_NOCCA (Uncharacterized protein OS=Noccaea caerulescens OX=107243 GN=GA_TR12192_c1_g1_i1_g.39043 PE=4 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 2.4e-04 Identity = 23/27 (85.19%), Postives = 24/27 (88.89%), Query Frame = 0
BLAST of MELO3C018771.2 vs. TrEMBL
Match: tr|A0A1J3K3A6|A0A1J3K3A6_NOCCA (Uncharacterized protein OS=Noccaea caerulescens OX=107243 GN=MP_TR4248_c0_g1_i1_g.11137 PE=4 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 2.4e-04 Identity = 23/27 (85.19%), Postives = 24/27 (88.89%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |