MELO3C013393 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTTTTCATTTGCCTAGAATTGTTCAAGCTAAACAAAGTCTTCGACGTTCTTCGTCAACTGGACATGGAACATCAGCGGTTGATGTTCCAAAGGGGTACTTTACAGTGTATATTGGTGAGGTACAAAAGAAGCGTTTCGTCATTCCTTTATCTTACTTGAACCTGCCTACTTTTCAAGATTTGTTGAGTCAAGGAGAAGAAGAATTTGGATATGATCATCCAATGGGTGGCATCACAATATCTTGCAGTGAAGAACTTTTCTTCGGTCTCACTCAAAGTTTGAAACACTTGTGA ATGGGTTTTCATTTGCCTAGAATTGTTCAAGCTAAACAAAGTCTTCGACGTTCTTCGTCAACTGGACATGGAACATCAGCGGTTGATGTTCCAAAGGGGTACTTTACAGTGTATATTGGTGAGGTACAAAAGAAGCGTTTCGTCATTCCTTTATCTTACTTGAACCTGCCTACTTTTCAAGATTTGTTGAGTCAAGGAGAAGAAGAATTTGGATATGATCATCCAATGGGTGGCATCACAATATCTTGCAGTGAAGAACTTTTCTTCGGTCTCACTCAAAGTTTGAAACACTTGTGA ATGGGTTTTCATTTGCCTAGAATTGTTCAAGCTAAACAAAGTCTTCGACGTTCTTCGTCAACTGGACATGGAACATCAGCGGTTGATGTTCCAAAGGGGTACTTTACAGTGTATATTGGTGAGGTACAAAAGAAGCGTTTCGTCATTCCTTTATCTTACTTGAACCTGCCTACTTTTCAAGATTTGTTGAGTCAAGGAGAAGAAGAATTTGGATATGATCATCCAATGGGTGGCATCACAATATCTTGCAGTGAAGAACTTTTCTTCGGTCTCACTCAAAGTTTGAAACACTTGTGA MGFHLPRIVQAKQSLRRSSSTGHGTSAVDVPKGYFTVYIGEVQKKRFVIPLSYLNLPTFQDLLSQGEEEFGYDHPMGGITISCSEELFFGLTQSLKHL*
BLAST of MELO3C013393 vs. Swiss-Prot
Match: ARG7_VIGRR (Indole-3-acetic acid-induced protein ARG7 OS=Vigna radiata var. radiata GN=ARG7 PE=2 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 1.5e-22 Identity = 55/95 (57.89%), Postives = 63/95 (66.32%), Query Frame = 1
BLAST of MELO3C013393 vs. Swiss-Prot
Match: AXX15_SOYBN (Auxin-induced protein X15 OS=Glycine max PE=2 SV=1) HSP 1 Score: 106.3 bits (264), Expect = 2.0e-22 Identity = 54/92 (58.70%), Postives = 64/92 (69.57%), Query Frame = 1
BLAST of MELO3C013393 vs. Swiss-Prot
Match: AX6B_SOYBN (Auxin-induced protein 6B OS=Glycine max PE=2 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 2.6e-22 Identity = 56/95 (58.95%), Postives = 66/95 (69.47%), Query Frame = 1
BLAST of MELO3C013393 vs. Swiss-Prot
Match: AX15A_SOYBN (Auxin-induced protein 15A OS=Glycine max PE=2 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 3.3e-22 Identity = 55/95 (57.89%), Postives = 63/95 (66.32%), Query Frame = 1
BLAST of MELO3C013393 vs. Swiss-Prot
Match: AX10A_SOYBN (Auxin-induced protein X10A OS=Glycine max PE=2 SV=1) HSP 1 Score: 104.8 bits (260), Expect = 5.7e-22 Identity = 52/98 (53.06%), Postives = 67/98 (68.37%), Query Frame = 1
BLAST of MELO3C013393 vs. TrEMBL
Match: A0A0A0K4J6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G009030 PE=4 SV=1) HSP 1 Score: 182.2 bits (461), Expect = 3.1e-43 Identity = 88/98 (89.80%), Postives = 93/98 (94.90%), Query Frame = 1
BLAST of MELO3C013393 vs. TrEMBL
Match: A0A0A0K4J0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G008980 PE=4 SV=1) HSP 1 Score: 152.1 bits (383), Expect = 3.5e-34 Identity = 77/97 (79.38%), Postives = 83/97 (85.57%), Query Frame = 1
BLAST of MELO3C013393 vs. TrEMBL
Match: A0A0A0K160_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G008990 PE=4 SV=1) HSP 1 Score: 151.8 bits (382), Expect = 4.5e-34 Identity = 75/97 (77.32%), Postives = 84/97 (86.60%), Query Frame = 1
BLAST of MELO3C013393 vs. TrEMBL
Match: A0A0A0K5T8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G009020 PE=4 SV=1) HSP 1 Score: 151.4 bits (381), Expect = 5.9e-34 Identity = 76/97 (78.35%), Postives = 82/97 (84.54%), Query Frame = 1
BLAST of MELO3C013393 vs. TrEMBL
Match: A0A0A0K0H9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G009010 PE=4 SV=1) HSP 1 Score: 148.3 bits (373), Expect = 5.0e-33 Identity = 73/97 (75.26%), Postives = 83/97 (85.57%), Query Frame = 1
BLAST of MELO3C013393 vs. TAIR10
Match: AT4G38840.1 (AT4G38840.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 112.8 bits (281), Expect = 1.2e-25 Identity = 53/94 (56.38%), Postives = 70/94 (74.47%), Query Frame = 1
BLAST of MELO3C013393 vs. TAIR10
Match: AT5G18080.1 (AT5G18080.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 101.3 bits (251), Expect = 3.5e-22 Identity = 49/89 (55.06%), Postives = 65/89 (73.03%), Query Frame = 1
BLAST of MELO3C013393 vs. TAIR10
Match: AT2G21210.1 (AT2G21210.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 99.8 bits (247), Expect = 1.0e-21 Identity = 46/96 (47.92%), Postives = 67/96 (69.79%), Query Frame = 1
BLAST of MELO3C013393 vs. TAIR10
Match: AT5G18020.1 (AT5G18020.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 99.0 bits (245), Expect = 1.8e-21 Identity = 46/85 (54.12%), Postives = 61/85 (71.76%), Query Frame = 1
BLAST of MELO3C013393 vs. TAIR10
Match: AT4G38850.1 (AT4G38850.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 98.2 bits (243), Expect = 3.0e-21 Identity = 48/88 (54.55%), Postives = 60/88 (68.18%), Query Frame = 1
BLAST of MELO3C013393 vs. NCBI nr
Match: gi|659094346|ref|XP_008448010.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis melo]) HSP 1 Score: 201.4 bits (511), Expect = 7.1e-49 Identity = 98/98 (100.00%), Postives = 98/98 (100.00%), Query Frame = 1
BLAST of MELO3C013393 vs. NCBI nr
Match: gi|449454325|ref|XP_004144906.1| (PREDICTED: auxin-induced protein X15-like [Cucumis sativus]) HSP 1 Score: 182.2 bits (461), Expect = 4.5e-43 Identity = 88/98 (89.80%), Postives = 93/98 (94.90%), Query Frame = 1
BLAST of MELO3C013393 vs. NCBI nr
Match: gi|659094350|ref|XP_008448013.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis melo]) HSP 1 Score: 152.1 bits (383), Expect = 5.0e-34 Identity = 78/100 (78.00%), Postives = 85/100 (85.00%), Query Frame = 1
BLAST of MELO3C013393 vs. NCBI nr
Match: gi|778722823|ref|XP_011658575.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]) HSP 1 Score: 152.1 bits (383), Expect = 5.0e-34 Identity = 77/97 (79.38%), Postives = 83/97 (85.57%), Query Frame = 1
BLAST of MELO3C013393 vs. NCBI nr
Match: gi|778722820|ref|XP_011658574.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]) HSP 1 Score: 151.8 bits (382), Expect = 6.5e-34 Identity = 75/97 (77.32%), Postives = 84/97 (86.60%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |