Csa7G009030 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: five_prime_UTRCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ATATTCCAAAAGAAAATTCCAAATTTTGTATTTATCTCAAAGTCTCACTAGTTCTTTCTCAAAAAATACTATAACATGGGTTTTCGTTTGCCTAGAATTGTTCAAGCTAAGCAAAGTCTTCGACGTTCTTCATCAACTGGAAATGGAACAACGGCGGTTGATGTTCCAAAGGGGTACTTCACAGTGTATGTTGGTGACGTACAAAAGAAGCGTTTCGTCATTCCTTTATCTTACTTGAACGAGCCTACTTTTCAAGATTTATTGAATCAAGCAGAAGAAGAATTTGGATATGATCATCCAATGGGTGGCATCACAATATCTTGCAGTGAAGAACTTTTCCTTGGTCTCACTCAAAGTTCGAAACACTTGTGAACTAGAGGAATGCAAACTAGAAATTGGTAGTATAGAAAAAGGATTAGAATAGTACAGAATGTAGACTGCATACTGTATATATTTTTGAAATGAGAG ATGGGTTTTCGTTTGCCTAGAATTGTTCAAGCTAAGCAAAGTCTTCGACGTTCTTCATCAACTGGAAATGGAACAACGGCGGTTGATGTTCCAAAGGGGTACTTCACAGTGTATGTTGGTGACGTACAAAAGAAGCGTTTCGTCATTCCTTTATCTTACTTGAACGAGCCTACTTTTCAAGATTTATTGAATCAAGCAGAAGAAGAATTTGGATATGATCATCCAATGGGTGGCATCACAATATCTTGCAGTGAAGAACTTTTCCTTGGTCTCACTCAAAGTTCGAAACACTTGTGA ATGGGTTTTCGTTTGCCTAGAATTGTTCAAGCTAAGCAAAGTCTTCGACGTTCTTCATCAACTGGAAATGGAACAACGGCGGTTGATGTTCCAAAGGGGTACTTCACAGTGTATGTTGGTGACGTACAAAAGAAGCGTTTCGTCATTCCTTTATCTTACTTGAACGAGCCTACTTTTCAAGATTTATTGAATCAAGCAGAAGAAGAATTTGGATATGATCATCCAATGGGTGGCATCACAATATCTTGCAGTGAAGAACTTTTCCTTGGTCTCACTCAAAGTTCGAAACACTTGTGA MGFRLPRIVQAKQSLRRSSSTGNGTTAVDVPKGYFTVYVGDVQKKRFVIPLSYLNEPTFQDLLNQAEEEFGYDHPMGGITISCSEELFLGLTQSSKHL*
BLAST of Csa7G009030 vs. Swiss-Prot
Match: AX10A_SOYBN (Auxin-induced protein X10A OS=Glycine max PE=2 SV=1) HSP 1 Score: 112.5 bits (280), Expect = 2.7e-24 Identity = 56/92 (60.87%), Postives = 69/92 (75.00%), Query Frame = 1
BLAST of Csa7G009030 vs. Swiss-Prot
Match: AXX15_SOYBN (Auxin-induced protein X15 OS=Glycine max PE=2 SV=1) HSP 1 Score: 110.2 bits (274), Expect = 1.4e-23 Identity = 56/92 (60.87%), Postives = 65/92 (70.65%), Query Frame = 1
BLAST of Csa7G009030 vs. Swiss-Prot
Match: A10A5_SOYBN (Auxin-induced protein 10A5 OS=Glycine max PE=2 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 3.0e-23 Identity = 58/94 (61.70%), Postives = 68/94 (72.34%), Query Frame = 1
BLAST of Csa7G009030 vs. Swiss-Prot
Match: ARG7_VIGRR (Indole-3-acetic acid-induced protein ARG7 OS=Vigna radiata var. radiata GN=ARG7 PE=2 SV=1) HSP 1 Score: 108.6 bits (270), Expect = 3.9e-23 Identity = 55/92 (59.78%), Postives = 65/92 (70.65%), Query Frame = 1
BLAST of Csa7G009030 vs. Swiss-Prot
Match: AX15A_SOYBN (Auxin-induced protein 15A OS=Glycine max PE=2 SV=1) HSP 1 Score: 107.8 bits (268), Expect = 6.7e-23 Identity = 55/92 (59.78%), Postives = 65/92 (70.65%), Query Frame = 1
BLAST of Csa7G009030 vs. TrEMBL
Match: A0A0A0K4J6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G009030 PE=4 SV=1) HSP 1 Score: 199.9 bits (507), Expect = 1.4e-48 Identity = 98/98 (100.00%), Postives = 98/98 (100.00%), Query Frame = 1
BLAST of Csa7G009030 vs. TrEMBL
Match: A0A0A0K4J0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G008980 PE=4 SV=1) HSP 1 Score: 155.2 bits (391), Expect = 4.1e-35 Identity = 76/96 (79.17%), Postives = 86/96 (89.58%), Query Frame = 1
BLAST of Csa7G009030 vs. TrEMBL
Match: A0A0A0K5T8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G009020 PE=4 SV=1) HSP 1 Score: 155.2 bits (391), Expect = 4.1e-35 Identity = 77/96 (80.21%), Postives = 85/96 (88.54%), Query Frame = 1
BLAST of Csa7G009030 vs. TrEMBL
Match: A0A0A0K160_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G008990 PE=4 SV=1) HSP 1 Score: 154.8 bits (390), Expect = 5.3e-35 Identity = 75/95 (78.95%), Postives = 87/95 (91.58%), Query Frame = 1
BLAST of Csa7G009030 vs. TrEMBL
Match: A0A0A0K0H9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G009010 PE=4 SV=1) HSP 1 Score: 151.0 bits (380), Expect = 7.7e-34 Identity = 73/96 (76.04%), Postives = 86/96 (89.58%), Query Frame = 1
BLAST of Csa7G009030 vs. TAIR10
Match: AT4G38840.1 (AT4G38840.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 117.9 bits (294), Expect = 3.7e-27 Identity = 54/94 (57.45%), Postives = 75/94 (79.79%), Query Frame = 1
BLAST of Csa7G009030 vs. TAIR10
Match: AT4G34770.1 (AT4G34770.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 101.3 bits (251), Expect = 3.5e-22 Identity = 55/99 (55.56%), Postives = 66/99 (66.67%), Query Frame = 1
BLAST of Csa7G009030 vs. TAIR10
Match: AT2G21210.1 (AT2G21210.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 100.9 bits (250), Expect = 4.6e-22 Identity = 46/92 (50.00%), Postives = 67/92 (72.83%), Query Frame = 1
BLAST of Csa7G009030 vs. TAIR10
Match: AT4G34800.1 (AT4G34800.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 100.9 bits (250), Expect = 4.6e-22 Identity = 50/96 (52.08%), Postives = 65/96 (67.71%), Query Frame = 1
BLAST of Csa7G009030 vs. TAIR10
Match: AT5G18080.1 (AT5G18080.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 100.1 bits (248), Expect = 7.9e-22 Identity = 47/85 (55.29%), Postives = 65/85 (76.47%), Query Frame = 1
BLAST of Csa7G009030 vs. NCBI nr
Match: gi|449454325|ref|XP_004144906.1| (PREDICTED: auxin-induced protein X15-like [Cucumis sativus]) HSP 1 Score: 199.9 bits (507), Expect = 2.1e-48 Identity = 98/98 (100.00%), Postives = 98/98 (100.00%), Query Frame = 1
BLAST of Csa7G009030 vs. NCBI nr
Match: gi|659094346|ref|XP_008448010.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis melo]) HSP 1 Score: 182.2 bits (461), Expect = 4.5e-43 Identity = 88/98 (89.80%), Postives = 93/98 (94.90%), Query Frame = 1
BLAST of Csa7G009030 vs. NCBI nr
Match: gi|778722823|ref|XP_011658575.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]) HSP 1 Score: 155.2 bits (391), Expect = 5.9e-35 Identity = 76/96 (79.17%), Postives = 86/96 (89.58%), Query Frame = 1
BLAST of Csa7G009030 vs. NCBI nr
Match: gi|778722830|ref|XP_004144905.2| (PREDICTED: auxin-induced protein X10A-like [Cucumis sativus]) HSP 1 Score: 155.2 bits (391), Expect = 5.9e-35 Identity = 77/96 (80.21%), Postives = 85/96 (88.54%), Query Frame = 1
BLAST of Csa7G009030 vs. NCBI nr
Match: gi|778722820|ref|XP_011658574.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]) HSP 1 Score: 154.8 bits (390), Expect = 7.6e-35 Identity = 75/95 (78.95%), Postives = 87/95 (91.58%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |