MELO3C005837 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAATTACCGCCTCAGGATTCAAACGGTTTTGTTGATGAGAAGTGTGAAAGCAAACTTTATATTGGCAATCTTGACCTCAGAATTACGGAGTAAGGAAAACTACTGTCCCAGCATTTGCAATGTATTTGTCTTCTAGTTTTCCCGCTTCTATACTAAAGTTTGAATCAATTTGTTTCAGAGCGGCCCTCATTAAACTCTTCTCTCCTTTTGGGAAGATAATATCTGAGGATTTCTTGTGGCACACCCGTGGGCCGAAGCGTGGAGAGCCACGAGGATTTGCCTTCATCGAGTACAGCTCCAAGGAGGTAAGTTGCTTGGTGTTTACCCCTTGA ATGGAATTACCGCCTCAGGATTCAAACGGTTTTGTTGATGAGAAGTGTGAAAGCAAACTTTATATTGGCAATCTTGACCTCAGAATTACGGAAGCGGCCCTCATTAAACTCTTCTCTCCTTTTGGGAAGATAATATCTGAGGATTTCTTGTGGCACACCCGTGGGCCGAAGCGTGGAGAGCCACGAGGATTTGCCTTCATCGAGTACAGCTCCAAGGAGGTAAGTTGCTTGGTGTTTACCCCTTGA ATGGAATTACCGCCTCAGGATTCAAACGGTTTTGTTGATGAGAAGTGTGAAAGCAAACTTTATATTGGCAATCTTGACCTCAGAATTACGGAAGCGGCCCTCATTAAACTCTTCTCTCCTTTTGGGAAGATAATATCTGAGGATTTCTTGTGGCACACCCGTGGGCCGAAGCGTGGAGAGCCACGAGGATTTGCCTTCATCGAGTACAGCTCCAAGGAGGTAAGTTGCTTGGTGTTTACCCCTTGA MELPPQDSNGFVDEKCESKLYIGNLDLRITEAALIKLFSPFGKIISEDFLWHTRGPKRGEPRGFAFIEYSSKEVSCLVFTP*
BLAST of MELO3C005837 vs. Swiss-Prot
Match: RBM18_DANRE (Probable RNA-binding protein 18 OS=Danio rerio GN=rbm18 PE=2 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 7.0e-10 Identity = 27/55 (49.09%), Postives = 37/55 (67.27%), Query Frame = 1
BLAST of MELO3C005837 vs. Swiss-Prot
Match: RBM18_XENLA (Probable RNA-binding protein 18 OS=Xenopus laevis GN=rbm18 PE=2 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 3.5e-09 Identity = 26/54 (48.15%), Postives = 36/54 (66.67%), Query Frame = 1
BLAST of MELO3C005837 vs. Swiss-Prot
Match: RBM18_MOUSE (Probable RNA-binding protein 18 OS=Mus musculus GN=Rbm18 PE=2 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 7.8e-09 Identity = 26/55 (47.27%), Postives = 36/55 (65.45%), Query Frame = 1
BLAST of MELO3C005837 vs. Swiss-Prot
Match: RBM18_PONAB (Probable RNA-binding protein 18 OS=Pongo abelii GN=RBM18 PE=2 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 7.8e-09 Identity = 26/55 (47.27%), Postives = 36/55 (65.45%), Query Frame = 1
BLAST of MELO3C005837 vs. Swiss-Prot
Match: RBM18_HUMAN (Probable RNA-binding protein 18 OS=Homo sapiens GN=RBM18 PE=2 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 7.8e-09 Identity = 26/55 (47.27%), Postives = 36/55 (65.45%), Query Frame = 1
BLAST of MELO3C005837 vs. TrEMBL
Match: A0A0A0KJM9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G140500 PE=4 SV=1) HSP 1 Score: 141.7 bits (356), Expect = 3.9e-31 Identity = 67/68 (98.53%), Postives = 68/68 (100.00%), Query Frame = 1
BLAST of MELO3C005837 vs. TrEMBL
Match: B9RIU0_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_1582780 PE=4 SV=1) HSP 1 Score: 132.1 bits (331), Expect = 3.1e-28 Identity = 58/68 (85.29%), Postives = 67/68 (98.53%), Query Frame = 1
BLAST of MELO3C005837 vs. TrEMBL
Match: A0A067JEG3_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_26067 PE=4 SV=1) HSP 1 Score: 127.9 bits (320), Expect = 5.8e-27 Identity = 57/67 (85.07%), Postives = 65/67 (97.01%), Query Frame = 1
BLAST of MELO3C005837 vs. TrEMBL
Match: A0A058ZYN7_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_K00291 PE=4 SV=1) HSP 1 Score: 126.3 bits (316), Expect = 1.7e-26 Identity = 59/67 (88.06%), Postives = 63/67 (94.03%), Query Frame = 1
BLAST of MELO3C005837 vs. TrEMBL
Match: I3SJ40_MEDTR (Uncharacterized protein OS=Medicago truncatula PE=2 SV=1) HSP 1 Score: 124.8 bits (312), Expect = 4.9e-26 Identity = 55/71 (77.46%), Postives = 66/71 (92.96%), Query Frame = 1
BLAST of MELO3C005837 vs. TAIR10
Match: AT5G03580.1 (AT5G03580.1 RNA-binding (RRM/RBD/RNP motifs) family protein) HSP 1 Score: 48.9 bits (115), Expect = 1.7e-06 Identity = 27/60 (45.00%), Postives = 35/60 (58.33%), Query Frame = 1
BLAST of MELO3C005837 vs. NCBI nr
Match: gi|700194748|gb|KGN49925.1| (hypothetical protein Csa_5G140500 [Cucumis sativus]) HSP 1 Score: 141.7 bits (356), Expect = 5.5e-31 Identity = 67/68 (98.53%), Postives = 68/68 (100.00%), Query Frame = 1
BLAST of MELO3C005837 vs. NCBI nr
Match: gi|778699047|ref|XP_011654647.1| (PREDICTED: probable RNA-binding protein 18 [Cucumis sativus]) HSP 1 Score: 141.0 bits (354), Expect = 9.5e-31 Identity = 67/67 (100.00%), Postives = 67/67 (100.00%), Query Frame = 1
BLAST of MELO3C005837 vs. NCBI nr
Match: gi|659074295|ref|XP_008437528.1| (PREDICTED: probable RNA-binding protein 18 [Cucumis melo]) HSP 1 Score: 141.0 bits (354), Expect = 9.5e-31 Identity = 67/67 (100.00%), Postives = 67/67 (100.00%), Query Frame = 1
BLAST of MELO3C005837 vs. NCBI nr
Match: gi|823182534|ref|XP_012488544.1| (PREDICTED: probable RNA-binding protein 18 isoform X1 [Gossypium raimondii]) HSP 1 Score: 134.0 bits (336), Expect = 1.2e-28 Identity = 61/74 (82.43%), Postives = 68/74 (91.89%), Query Frame = 1
BLAST of MELO3C005837 vs. NCBI nr
Match: gi|223547567|gb|EEF49062.1| (conserved hypothetical protein [Ricinus communis]) HSP 1 Score: 132.1 bits (331), Expect = 4.4e-28 Identity = 58/68 (85.29%), Postives = 67/68 (98.53%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |