MELO3C004902.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTTGAATCAAGATCGGGTTCTAAAACGAGTCTGGCAACACGACTTAAGTTGGACAGTGAGACATCAGATTGTTGGGGAACTTTATACCAACTTCAAGCTTGCACAGGTGAAGTTGTCACATTTTTTCTTACTGGTGAAACTTATTTAGGTTCCAATTGTTGTCAAGCTATTAAAGTCATTCAACATGAGTGCTGGCCAACATTACTCGAGTCTTTAGGATACACGACTGAAGAAGGTGACATTCTTGAAGCCTATTGCAATACCACTATTGATACTCTCAAAACATCATCATCTTCTGATCTATCGTTATCTATTGAGCAAAATACTGCGGCTAAAATCATTGCTCCATGA ATGGTTGAATCAAGATCGGGTTCTAAAACGAGTCTGGCAACACGACTTAAGTTGGACAGTGAGACATCAGATTGTTGGGGAACTTTATACCAACTTCAAGCTTGCACAGGTGAAGTTGTCACATTTTTTCTTACTGGTGAAACTTATTTAGGTTCCAATTGTTGTCAAGCTATTAAAGTCATTCAACATGAGTGCTGGCCAACATTACTCGAGTCTTTAGGATACACGACTGAAGAAGGTGACATTCTTGAAGCCTATTGCAATACCACTATTGATACTCTCAAAACATCATCATCTTCTGATCTATCGTTATCTATTGAGCAAAATACTGCGGCTAAAATCATTGCTCCATGA ATGGTTGAATCAAGATCGGGTTCTAAAACGAGTCTGGCAACACGACTTAAGTTGGACAGTGAGACATCAGATTGTTGGGGAACTTTATACCAACTTCAAGCTTGCACAGGTGAAGTTGTCACATTTTTTCTTACTGGTGAAACTTATTTAGGTTCCAATTGTTGTCAAGCTATTAAAGTCATTCAACATGAGTGCTGGCCAACATTACTCGAGTCTTTAGGATACACGACTGAAGAAGGTGACATTCTTGAAGCCTATTGCAATACCACTATTGATACTCTCAAAACATCATCATCTTCTGATCTATCGTTATCTATTGAGCAAAATACTGCGGCTAAAATCATTGCTCCATGA MVESRSGSKTSLATRLKLDSETSDCWGTLYQLQACTGEVVTFFLTGETYLGSNCCQAIKVIQHECWPTLLESLGYTTEEGDILEAYCNTTIDTLKTSSSSDLSLSIEQNTAAKIIAP
BLAST of MELO3C004902.2 vs. NCBI nr
Match: KGN64837.1 (hypothetical protein Csa_1G124010 [Cucumis sativus]) HSP 1 Score: 203.4 bits (516), Expect = 4.3e-49 Identity = 102/117 (87.18%), Postives = 107/117 (91.45%), Query Frame = 0
BLAST of MELO3C004902.2 vs. NCBI nr
Match: XP_022998660.1 (egg cell-secreted protein 1.1-like [Cucurbita maxima]) HSP 1 Score: 164.1 bits (414), Expect = 2.9e-37 Identity = 82/118 (69.49%), Postives = 95/118 (80.51%), Query Frame = 0
BLAST of MELO3C004902.2 vs. NCBI nr
Match: XP_022998659.1 (egg cell-secreted protein 1.1-like [Cucurbita maxima]) HSP 1 Score: 164.1 bits (414), Expect = 2.9e-37 Identity = 81/119 (68.07%), Postives = 96/119 (80.67%), Query Frame = 0
BLAST of MELO3C004902.2 vs. NCBI nr
Match: KGN64838.1 (hypothetical protein Csa_1G124020 [Cucumis sativus]) HSP 1 Score: 159.1 bits (401), Expect = 9.3e-36 Identity = 76/106 (71.70%), Postives = 89/106 (83.96%), Query Frame = 0
BLAST of MELO3C004902.2 vs. NCBI nr
Match: XP_023524588.1 (egg cell-secreted protein 1.1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 159.1 bits (401), Expect = 9.3e-36 Identity = 78/118 (66.10%), Postives = 94/118 (79.66%), Query Frame = 0
BLAST of MELO3C004902.2 vs. TAIR10
Match: AT1G76750.1 (Protein of unknown function (DUF1278)) HSP 1 Score: 107.1 bits (266), Expect = 7.6e-24 Identity = 52/118 (44.07%), Postives = 71/118 (60.17%), Query Frame = 0
BLAST of MELO3C004902.2 vs. TAIR10
Match: AT2G21740.1 (Protein of unknown function (DUF1278)) HSP 1 Score: 92.4 bits (228), Expect = 1.9e-19 Identity = 38/80 (47.50%), Postives = 57/80 (71.25%), Query Frame = 0
BLAST of MELO3C004902.2 vs. TAIR10
Match: AT4G39340.1 (Protein of unknown function (DUF1278)) HSP 1 Score: 91.3 bits (225), Expect = 4.3e-19 Identity = 37/80 (46.25%), Postives = 55/80 (68.75%), Query Frame = 0
BLAST of MELO3C004902.2 vs. TAIR10
Match: AT2G21750.1 (Protein of unknown function (DUF1278)) HSP 1 Score: 88.2 bits (217), Expect = 3.7e-18 Identity = 38/80 (47.50%), Postives = 52/80 (65.00%), Query Frame = 0
BLAST of MELO3C004902.2 vs. Swiss-Prot
Match: sp|Q9SRD8|EC11_ARATH (Egg cell-secreted protein 1.1 OS=Arabidopsis thaliana OX=3702 GN=EC1.1 PE=2 SV=1) HSP 1 Score: 107.1 bits (266), Expect = 1.4e-22 Identity = 52/118 (44.07%), Postives = 71/118 (60.17%), Query Frame = 0
BLAST of MELO3C004902.2 vs. Swiss-Prot
Match: sp|Q9SJ24|EC12_ARATH (Egg cell-secreted protein 1.2 OS=Arabidopsis thaliana OX=3702 GN=EC1.2 PE=2 SV=1) HSP 1 Score: 92.4 bits (228), Expect = 3.5e-18 Identity = 38/80 (47.50%), Postives = 57/80 (71.25%), Query Frame = 0
BLAST of MELO3C004902.2 vs. Swiss-Prot
Match: sp|Q9T039|EC14_ARATH (Egg cell-secreted protein 1.4 OS=Arabidopsis thaliana OX=3702 GN=EC1.4 PE=2 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 7.8e-18 Identity = 37/80 (46.25%), Postives = 55/80 (68.75%), Query Frame = 0
BLAST of MELO3C004902.2 vs. Swiss-Prot
Match: sp|Q9SJ23|EC13_ARATH (Egg cell-secreted protein 1.3 OS=Arabidopsis thaliana OX=3702 GN=EC1.3 PE=2 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 6.6e-17 Identity = 38/80 (47.50%), Postives = 52/80 (65.00%), Query Frame = 0
BLAST of MELO3C004902.2 vs. TrEMBL
Match: tr|A0A0A0LVH9|A0A0A0LVH9_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G124010 PE=4 SV=1) HSP 1 Score: 203.4 bits (516), Expect = 2.9e-49 Identity = 102/117 (87.18%), Postives = 107/117 (91.45%), Query Frame = 0
BLAST of MELO3C004902.2 vs. TrEMBL
Match: tr|A0A0A0LSR4|A0A0A0LSR4_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G124020 PE=4 SV=1) HSP 1 Score: 159.1 bits (401), Expect = 6.2e-36 Identity = 76/106 (71.70%), Postives = 89/106 (83.96%), Query Frame = 0
BLAST of MELO3C004902.2 vs. TrEMBL
Match: tr|A0A1S3CM80|A0A1S3CM80_CUCME (egg cell-secreted protein 1.2-like OS=Cucumis melo OX=3656 GN=LOC103502392 PE=4 SV=1) HSP 1 Score: 153.3 bits (386), Expect = 3.4e-34 Identity = 76/108 (70.37%), Postives = 88/108 (81.48%), Query Frame = 0
BLAST of MELO3C004902.2 vs. TrEMBL
Match: tr|A0A0B2SQ80|A0A0B2SQ80_GLYSO (Uncharacterized protein OS=Glycine soja OX=3848 GN=glysoja_031725 PE=4 SV=1) HSP 1 Score: 131.3 bits (329), Expect = 1.4e-27 Identity = 54/90 (60.00%), Postives = 74/90 (82.22%), Query Frame = 0
BLAST of MELO3C004902.2 vs. TrEMBL
Match: tr|K7LEW0|K7LEW0_SOYBN (Uncharacterized protein OS=Glycine max OX=3847 GN=102667984 PE=4 SV=1) HSP 1 Score: 129.8 bits (325), Expect = 4.0e-27 Identity = 57/95 (60.00%), Postives = 75/95 (78.95%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|