Cla003430 (gene) Watermelon (97103) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTCGAATCAAGATCAAACCCTACAACGAGTTTAGAAGAACGACTTAAGTTGAATGGCGAGACATTAGATTGCTGGGGAACTTTGCACAAACTTCAAGCATGCACGGGTGAAGTTATCACATTTTTTCTTACTGGTGAAACTTATTTAGGTTCCAACTGTTGTCAAGCTATTAAAATCATTCAACATGAGTGTTGGCCAACATTGCTTGGATCTTTGGGATATACGACAGAAGAAGGTGACATACTTGAAGCCTATTGTGATACCACTATTGATGGTCTTACAACACTGTCATCTCCTCTATCGTTCTTTATCGAACAAAACGCAGTAACTAAAATTGTTACTCCATGA ATGGTCGAATCAAGATCAAACCCTACAACGAGTTTAGAAGAACGACTTAAGTTGAATGGCGAGACATTAGATTGCTGGGGAACTTTGCACAAACTTCAAGCATGCACGGGTGAAGTTATCACATTTTTTCTTACTGGTGAAACTTATTTAGGTTCCAACTGTTGTCAAGCTATTAAAATCATTCAACATGAGTGTTGGCCAACATTGCTTGGATCTTTGGGATATACGACAGAAGAAGGTGACATACTTGAAGCCTATTGTGATACCACTATTGATGGTCTTACAACACTGTCATCTCCTCTATCGTTCTTTATCGAACAAAACGCAGTAACTAAAATTGTTACTCCATGA ATGGTCGAATCAAGATCAAACCCTACAACGAGTTTAGAAGAACGACTTAAGTTGAATGGCGAGACATTAGATTGCTGGGGAACTTTGCACAAACTTCAAGCATGCACGGGTGAAGTTATCACATTTTTTCTTACTGGTGAAACTTATTTAGGTTCCAACTGTTGTCAAGCTATTAAAATCATTCAACATGAGTGTTGGCCAACATTGCTTGGATCTTTGGGATATACGACAGAAGAAGGTGACATACTTGAAGCCTATTGTGATACCACTATTGATGGTCTTACAACACTGTCATCTCCTCTATCGTTCTTTATCGAACAAAACGCAGTAACTAAAATTGTTACTCCATGA MVESRSNPTTSLEERLKLNGETLDCWGTLHKLQACTGEVITFFLTGETYLGSNCCQAIKIIQHECWPTLLGSLGYTTEEGDILEAYCDTTIDGLTTLSSPLSFFIEQNAVTKIVTP
BLAST of Cla003430 vs. Swiss-Prot
Match: EC11_ARATH (Egg cell-secreted protein 1.1 OS=Arabidopsis thaliana GN=EC1.1 PE=2 SV=1) HSP 1 Score: 112.5 bits (280), Expect = 3.2e-24 Identity = 48/83 (57.83%), Postives = 62/83 (74.70%), Query Frame = 1
BLAST of Cla003430 vs. Swiss-Prot
Match: EC12_ARATH (Egg cell-secreted protein 1.2 OS=Arabidopsis thaliana GN=EC1.2 PE=2 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 5.8e-18 Identity = 36/85 (42.35%), Postives = 58/85 (68.24%), Query Frame = 1
BLAST of Cla003430 vs. Swiss-Prot
Match: EC14_ARATH (Egg cell-secreted protein 1.4 OS=Arabidopsis thaliana GN=EC1.4 PE=2 SV=1) HSP 1 Score: 89.7 bits (221), Expect = 2.2e-17 Identity = 36/85 (42.35%), Postives = 56/85 (65.88%), Query Frame = 1
BLAST of Cla003430 vs. Swiss-Prot
Match: EC13_ARATH (Egg cell-secreted protein 1.3 OS=Arabidopsis thaliana GN=EC1.3 PE=2 SV=1) HSP 1 Score: 88.6 bits (218), Expect = 4.9e-17 Identity = 40/96 (41.67%), Postives = 58/96 (60.42%), Query Frame = 1
BLAST of Cla003430 vs. Swiss-Prot
Match: EC15_ARATH (Egg cell-secreted protein 1.5 OS=Arabidopsis thaliana GN=EC1.5 PE=2 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 4.9e-09 Identity = 29/77 (37.66%), Postives = 42/77 (54.55%), Query Frame = 1
BLAST of Cla003430 vs. TrEMBL
Match: A0A0A0LVH9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G124010 PE=4 SV=1) HSP 1 Score: 196.1 bits (497), Expect = 2.4e-47 Identity = 91/116 (78.45%), Postives = 100/116 (86.21%), Query Frame = 1
BLAST of Cla003430 vs. TrEMBL
Match: A0A0A0LSR4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G124020 PE=4 SV=1) HSP 1 Score: 164.1 bits (414), Expect = 1.0e-37 Identity = 77/101 (76.24%), Postives = 86/101 (85.15%), Query Frame = 1
BLAST of Cla003430 vs. TrEMBL
Match: K7N3Y2_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_20G168300 PE=4 SV=1) HSP 1 Score: 136.0 bits (341), Expect = 3.0e-29 Identity = 64/117 (54.70%), Postives = 85/117 (72.65%), Query Frame = 1
BLAST of Cla003430 vs. TrEMBL
Match: A0A0B2SQ80_GLYSO (Uncharacterized protein OS=Glycine soja GN=glysoja_031725 PE=4 SV=1) HSP 1 Score: 136.0 bits (341), Expect = 3.0e-29 Identity = 64/117 (54.70%), Postives = 85/117 (72.65%), Query Frame = 1
BLAST of Cla003430 vs. TrEMBL
Match: A0A0B2S0S1_GLYSO (Uncharacterized protein OS=Glycine soja GN=glysoja_014832 PE=4 SV=1) HSP 1 Score: 128.6 bits (322), Expect = 4.8e-27 Identity = 56/94 (59.57%), Postives = 73/94 (77.66%), Query Frame = 1
BLAST of Cla003430 vs. NCBI nr
Match: gi|700209741|gb|KGN64837.1| (hypothetical protein Csa_1G124010 [Cucumis sativus]) HSP 1 Score: 196.1 bits (497), Expect = 3.5e-47 Identity = 91/116 (78.45%), Postives = 100/116 (86.21%), Query Frame = 1
BLAST of Cla003430 vs. NCBI nr
Match: gi|659072260|ref|XP_008464551.1| (PREDICTED: egg cell-secreted protein 1.1-like [Cucumis melo]) HSP 1 Score: 179.9 bits (455), Expect = 2.6e-42 Identity = 87/113 (76.99%), Postives = 95/113 (84.07%), Query Frame = 1
BLAST of Cla003430 vs. NCBI nr
Match: gi|700209742|gb|KGN64838.1| (hypothetical protein Csa_1G124020 [Cucumis sativus]) HSP 1 Score: 164.1 bits (414), Expect = 1.5e-37 Identity = 77/101 (76.24%), Postives = 86/101 (85.15%), Query Frame = 1
BLAST of Cla003430 vs. NCBI nr
Match: gi|659072258|ref|XP_008464543.1| (PREDICTED: egg cell-secreted protein 1.2-like [Cucumis melo]) HSP 1 Score: 161.8 bits (408), Expect = 7.3e-37 Identity = 79/103 (76.70%), Postives = 86/103 (83.50%), Query Frame = 1
BLAST of Cla003430 vs. NCBI nr
Match: gi|356574547|ref|XP_003555407.1| (PREDICTED: egg cell-secreted protein 1.1-like [Glycine max]) HSP 1 Score: 136.0 bits (341), Expect = 4.3e-29 Identity = 64/117 (54.70%), Postives = 85/117 (72.65%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|