Csa1G124010 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTTGAATCAAGACCAGATCCTAAAACAAGTCTAGCAACACGACTTAAGTTGGATAGCGAGACATCAGATTGTTGGGGAACTTTGCACGAACTTCAAGCCTGCACAGGTGAAGTTGTCACATTTTTTCTTACTGGTGAAACTTATTTAGGTTCCAATTGTTGTCAAGCTATTAAAGTCATTCAACATGAGTGTTGGCCAACATTGCTTGCATCTCTGGGATACACGACTGAAGAAGGTGACGTTCTTGAAGCCTATTGCGATACCACTATCGATACTATCAAAACATCATCATCTCCTCTATCATTATCTATCGAGCAAAATAATATGCCTAAAAGCATTGCTCCATGA ATGGTTGAATCAAGACCAGATCCTAAAACAAGTCTAGCAACACGACTTAAGTTGGATAGCGAGACATCAGATTGTTGGGGAACTTTGCACGAACTTCAAGCCTGCACAGGTGAAGTTGTCACATTTTTTCTTACTGGTGAAACTTATTTAGGTTCCAATTGTTGTCAAGCTATTAAAGTCATTCAACATGAGTGTTGGCCAACATTGCTTGCATCTCTGGGATACACGACTGAAGAAGGTGACGTTCTTGAAGCCTATTGCGATACCACTATCGATACTATCAAAACATCATCATCTCCTCTATCATTATCTATCGAGCAAAATAATATGCCTAAAAGCATTGCTCCATGA ATGGTTGAATCAAGACCAGATCCTAAAACAAGTCTAGCAACACGACTTAAGTTGGATAGCGAGACATCAGATTGTTGGGGAACTTTGCACGAACTTCAAGCCTGCACAGGTGAAGTTGTCACATTTTTTCTTACTGGTGAAACTTATTTAGGTTCCAATTGTTGTCAAGCTATTAAAGTCATTCAACATGAGTGTTGGCCAACATTGCTTGCATCTCTGGGATACACGACTGAAGAAGGTGACGTTCTTGAAGCCTATTGCGATACCACTATCGATACTATCAAAACATCATCATCTCCTCTATCATTATCTATCGAGCAAAATAATATGCCTAAAAGCATTGCTCCATGA MVESRPDPKTSLATRLKLDSETSDCWGTLHELQACTGEVVTFFLTGETYLGSNCCQAIKVIQHECWPTLLASLGYTTEEGDVLEAYCDTTIDTIKTSSSPLSLSIEQNNMPKSIAP*
BLAST of Csa1G124010 vs. Swiss-Prot
Match: EC11_ARATH (Egg cell-secreted protein 1.1 OS=Arabidopsis thaliana GN=EC1.1 PE=2 SV=1) HSP 1 Score: 113.6 bits (283), Expect = 1.4e-24 Identity = 51/116 (43.97%), Postives = 72/116 (62.07%), Query Frame = 1
BLAST of Csa1G124010 vs. Swiss-Prot
Match: EC12_ARATH (Egg cell-secreted protein 1.2 OS=Arabidopsis thaliana GN=EC1.2 PE=2 SV=1) HSP 1 Score: 92.8 bits (229), Expect = 2.6e-18 Identity = 39/83 (46.99%), Postives = 56/83 (67.47%), Query Frame = 1
BLAST of Csa1G124010 vs. Swiss-Prot
Match: EC14_ARATH (Egg cell-secreted protein 1.4 OS=Arabidopsis thaliana GN=EC1.4 PE=2 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 1.7e-17 Identity = 37/81 (45.68%), Postives = 53/81 (65.43%), Query Frame = 1
BLAST of Csa1G124010 vs. Swiss-Prot
Match: EC13_ARATH (Egg cell-secreted protein 1.3 OS=Arabidopsis thaliana GN=EC1.3 PE=2 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 6.5e-17 Identity = 39/80 (48.75%), Postives = 50/80 (62.50%), Query Frame = 1
BLAST of Csa1G124010 vs. Swiss-Prot
Match: EC15_ARATH (Egg cell-secreted protein 1.5 OS=Arabidopsis thaliana GN=EC1.5 PE=2 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 1.6e-10 Identity = 38/108 (35.19%), Postives = 53/108 (49.07%), Query Frame = 1
BLAST of Csa1G124010 vs. TrEMBL
Match: A0A0A0LVH9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G124010 PE=4 SV=1) HSP 1 Score: 241.5 bits (615), Expect = 5.1e-61 Identity = 116/116 (100.00%), Postives = 116/116 (100.00%), Query Frame = 1
BLAST of Csa1G124010 vs. TrEMBL
Match: A0A0A0LSR4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G124020 PE=4 SV=1) HSP 1 Score: 170.2 bits (430), Expect = 1.4e-39 Identity = 79/119 (66.39%), Postives = 96/119 (80.67%), Query Frame = 1
BLAST of Csa1G124010 vs. TrEMBL
Match: K7N3Y2_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_20G168300 PE=4 SV=1) HSP 1 Score: 139.4 bits (350), Expect = 2.7e-30 Identity = 60/99 (60.61%), Postives = 77/99 (77.78%), Query Frame = 1
BLAST of Csa1G124010 vs. TrEMBL
Match: A0A0B2SQ80_GLYSO (Uncharacterized protein OS=Glycine soja GN=glysoja_031725 PE=4 SV=1) HSP 1 Score: 139.4 bits (350), Expect = 2.7e-30 Identity = 60/99 (60.61%), Postives = 77/99 (77.78%), Query Frame = 1
BLAST of Csa1G124010 vs. TrEMBL
Match: A0A0A0K9I7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G056550 PE=4 SV=1) HSP 1 Score: 137.1 bits (344), Expect = 1.4e-29 Identity = 63/116 (54.31%), Postives = 82/116 (70.69%), Query Frame = 1
BLAST of Csa1G124010 vs. TAIR10
Match: AT1G76750.1 (AT1G76750.1 Protein of unknown function (DUF1278)) HSP 1 Score: 113.6 bits (283), Expect = 8.1e-26 Identity = 51/116 (43.97%), Postives = 72/116 (62.07%), Query Frame = 1
BLAST of Csa1G124010 vs. TAIR10
Match: AT2G21740.1 (AT2G21740.1 Protein of unknown function (DUF1278)) HSP 1 Score: 92.8 bits (229), Expect = 1.5e-19 Identity = 39/83 (46.99%), Postives = 56/83 (67.47%), Query Frame = 1
BLAST of Csa1G124010 vs. TAIR10
Match: AT4G39340.1 (AT4G39340.1 Protein of unknown function (DUF1278)) HSP 1 Score: 90.1 bits (222), Expect = 9.6e-19 Identity = 37/81 (45.68%), Postives = 53/81 (65.43%), Query Frame = 1
BLAST of Csa1G124010 vs. TAIR10
Match: AT2G21750.1 (AT2G21750.1 Protein of unknown function (DUF1278)) HSP 1 Score: 88.2 bits (217), Expect = 3.7e-18 Identity = 39/80 (48.75%), Postives = 50/80 (62.50%), Query Frame = 1
BLAST of Csa1G124010 vs. TAIR10
Match: AT5G64720.1 (AT5G64720.1 Protein of unknown function (DUF1278)) HSP 1 Score: 67.0 bits (162), Expect = 8.7e-12 Identity = 38/108 (35.19%), Postives = 53/108 (49.07%), Query Frame = 1
BLAST of Csa1G124010 vs. NCBI nr
Match: gi|700209741|gb|KGN64837.1| (hypothetical protein Csa_1G124010 [Cucumis sativus]) HSP 1 Score: 241.5 bits (615), Expect = 7.3e-61 Identity = 116/116 (100.00%), Postives = 116/116 (100.00%), Query Frame = 1
BLAST of Csa1G124010 vs. NCBI nr
Match: gi|659072260|ref|XP_008464551.1| (PREDICTED: egg cell-secreted protein 1.1-like [Cucumis melo]) HSP 1 Score: 199.5 bits (506), Expect = 3.2e-48 Identity = 98/113 (86.73%), Postives = 103/113 (91.15%), Query Frame = 1
BLAST of Csa1G124010 vs. NCBI nr
Match: gi|700209742|gb|KGN64838.1| (hypothetical protein Csa_1G124020 [Cucumis sativus]) HSP 1 Score: 170.2 bits (430), Expect = 2.1e-39 Identity = 79/119 (66.39%), Postives = 96/119 (80.67%), Query Frame = 1
BLAST of Csa1G124010 vs. NCBI nr
Match: gi|659072258|ref|XP_008464543.1| (PREDICTED: egg cell-secreted protein 1.2-like [Cucumis melo]) HSP 1 Score: 164.9 bits (416), Expect = 8.7e-38 Identity = 78/103 (75.73%), Postives = 88/103 (85.44%), Query Frame = 1
BLAST of Csa1G124010 vs. NCBI nr
Match: gi|659081784|ref|XP_008441511.1| (PREDICTED: egg cell-secreted protein 1.2 [Cucumis melo]) HSP 1 Score: 140.6 bits (353), Expect = 1.8e-30 Identity = 65/116 (56.03%), Postives = 84/116 (72.41%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|