MELO3C004787 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCTAATTGCGCTCACTCCATCACAGAATGCCTTGGTTTCTGATCGACTTCTTAGGCATTCAAATATTAATGTCAAAGTTGCAGTTGCAGCATGCGTTAGTGAAATAACTCGGATCATTGCACCTAATGCCCCTTACAGTGATGGAAATATGAAGGTAATCAGAAATTTGCTCGATTGAATGCCAATTTCCCACTTGTCGAATCTACTTCTAAAGAGTTGAATGTATGCTGCTGTTCAGGAGGTATTTCATCTTATAGTATCATCCTTTGAAAATCTCTCTGACAAGTCAAGTCGATCATATGTAAAATGCGCATCCATTCTTGAAACTGTTCCGAGGGTCAGATTATATGTGGCCATGCTGGATTTGGAATGTGATGCATTGATATGTTCCAACATTTCCTTAAGACAGTAA ATGCTAATTGCGCTCACTCCATCACAGAATGCCTTGGTTTCTGATCGACTTCTTAGGCATTCAAATATTAATGTCAAAGTTGCAGTTGCAGCATGCGTTAGTGAAATAACTCGGATCATTGCACCTAATGCCCCTTACAGTGATGGAAATATGAAGGAGGTATTTCATCTTATAGTATCATCCTTTGAAAATCTCTCTGACAAGTCAAGTCGATCATATGTAAAATGCGCATCCATTCTTGAAACTGTTCCGAGGGTCAGATTATATGTGGCCATGCTGGATTTGGAATGTGATGCATTGATATGTTCCAACATTTCCTTAAGACAGTAA ATGCTAATTGCGCTCACTCCATCACAGAATGCCTTGGTTTCTGATCGACTTCTTAGGCATTCAAATATTAATGTCAAAGTTGCAGTTGCAGCATGCGTTAGTGAAATAACTCGGATCATTGCACCTAATGCCCCTTACAGTGATGGAAATATGAAGGAGGTATTTCATCTTATAGTATCATCCTTTGAAAATCTCTCTGACAAGTCAAGTCGATCATATGTAAAATGCGCATCCATTCTTGAAACTGTTCCGAGGGTCAGATTATATGTGGCCATGCTGGATTTGGAATGTGATGCATTGATATGTTCCAACATTTCCTTAAGACAGTAA MLIALTPSQNALVSDRLLRHSNINVKVAVAACVSEITRIIAPNAPYSDGNMKEVFHLIVSSFENLSDKSSRSYVKCASILETVPRVRLYVAMLDLECDALICSNISLRQ*
BLAST of MELO3C004787 vs. Swiss-Prot
Match: CTU1_ARATH (Cytoplasmic tRNA 2-thiolation protein 1 OS=Arabidopsis thaliana GN=NCS6 PE=2 SV=2) HSP 1 Score: 124.8 bits (312), Expect = 7.0e-28 Identity = 64/95 (67.37%), Postives = 74/95 (77.89%), Query Frame = 1
BLAST of MELO3C004787 vs. Swiss-Prot
Match: CTU1_ORYSJ (Cytoplasmic tRNA 2-thiolation protein 1 OS=Oryza sativa subsp. japonica GN=NCS6 PE=2 SV=1) HSP 1 Score: 122.1 bits (305), Expect = 4.5e-27 Identity = 59/74 (79.73%), Postives = 65/74 (87.84%), Query Frame = 1
BLAST of MELO3C004787 vs. Swiss-Prot
Match: CTU1_XENLA (Cytoplasmic tRNA 2-thiolation protein 1 OS=Xenopus laevis GN=ctu1 PE=2 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 4.4e-22 Identity = 49/74 (66.22%), Postives = 59/74 (79.73%), Query Frame = 1
BLAST of MELO3C004787 vs. Swiss-Prot
Match: CTU1_DANRE (Cytoplasmic tRNA 2-thiolation protein 1 OS=Danio rerio GN=ctu1 PE=2 SV=1) HSP 1 Score: 104.0 bits (258), Expect = 1.3e-21 Identity = 51/76 (67.11%), Postives = 60/76 (78.95%), Query Frame = 1
BLAST of MELO3C004787 vs. Swiss-Prot
Match: CTU1_XENTR (Cytoplasmic tRNA 2-thiolation protein 1 OS=Xenopus tropicalis GN=ctu1 PE=2 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 2.8e-21 Identity = 48/74 (64.86%), Postives = 58/74 (78.38%), Query Frame = 1
BLAST of MELO3C004787 vs. TrEMBL
Match: A0A059BW08_EUCGR (Cytoplasmic tRNA 2-thiolation protein 1 OS=Eucalyptus grandis GN=NCS6 PE=3 SV=1) HSP 1 Score: 128.3 bits (321), Expect = 7.0e-27 Identity = 67/95 (70.53%), Postives = 77/95 (81.05%), Query Frame = 1
BLAST of MELO3C004787 vs. TrEMBL
Match: A0A0A0LKF0_CUCSA (Cytoplasmic tRNA 2-thiolation protein 1 OS=Cucumis sativus GN=NCS6 PE=3 SV=1) HSP 1 Score: 127.5 bits (319), Expect = 1.2e-26 Identity = 67/95 (70.53%), Postives = 76/95 (80.00%), Query Frame = 1
BLAST of MELO3C004787 vs. TrEMBL
Match: A0A151SFJ5_CAJCA (Cytoplasmic tRNA 2-thiolation protein 1 OS=Cajanus cajan GN=KK1_024469 PE=4 SV=1) HSP 1 Score: 126.7 bits (317), Expect = 2.0e-26 Identity = 67/115 (58.26%), Postives = 83/115 (72.17%), Query Frame = 1
BLAST of MELO3C004787 vs. TrEMBL
Match: A0A087GX57_ARAAL (Cytoplasmic tRNA 2-thiolation protein 1 OS=Arabis alpina GN=NCS6 PE=3 SV=1) HSP 1 Score: 124.8 bits (312), Expect = 7.8e-26 Identity = 64/95 (67.37%), Postives = 76/95 (80.00%), Query Frame = 1
BLAST of MELO3C004787 vs. TrEMBL
Match: A0A067KKS9_JATCU (Cytoplasmic tRNA 2-thiolation protein 1 OS=Jatropha curcas GN=NCS6 PE=3 SV=1) HSP 1 Score: 124.8 bits (312), Expect = 7.8e-26 Identity = 64/95 (67.37%), Postives = 77/95 (81.05%), Query Frame = 1
BLAST of MELO3C004787 vs. TAIR10
Match: AT1G76170.1 (AT1G76170.1 2-thiocytidine tRNA biosynthesis protein, TtcA) HSP 1 Score: 123.2 bits (308), Expect = 1.1e-28 Identity = 63/95 (66.32%), Postives = 74/95 (77.89%), Query Frame = 1
BLAST of MELO3C004787 vs. TAIR10
Match: AT2G44270.2 (AT2G44270.2 repressor of lrx1) HSP 1 Score: 109.0 bits (271), Expect = 2.2e-24 Identity = 56/86 (65.12%), Postives = 65/86 (75.58%), Query Frame = 1
BLAST of MELO3C004787 vs. TAIR10
Match: AT4G31880.1 (AT4G31880.1 LOCATED IN: cytosol, chloroplast) HSP 1 Score: 68.9 bits (167), Expect = 2.6e-12 Identity = 32/50 (64.00%), Postives = 37/50 (74.00%), Query Frame = 1
BLAST of MELO3C004787 vs. TAIR10
Match: AT1G80810.2 (AT1G80810.2 Tudor/PWWP/MBT superfamily protein) HSP 1 Score: 58.9 bits (141), Expect = 2.6e-09 Identity = 30/53 (56.60%), Postives = 36/53 (67.92%), Query Frame = 1
BLAST of MELO3C004787 vs. TAIR10
Match: AT5G47690.3 (AT5G47690.3 binding) HSP 1 Score: 55.8 bits (133), Expect = 2.2e-08 Identity = 26/53 (49.06%), Postives = 36/53 (67.92%), Query Frame = 1
BLAST of MELO3C004787 vs. NCBI nr
Match: gi|702378815|ref|XP_010063105.1| (PREDICTED: cytoplasmic tRNA 2-thiolation protein 1 [Eucalyptus grandis]) HSP 1 Score: 128.3 bits (321), Expect = 1.0e-26 Identity = 67/95 (70.53%), Postives = 77/95 (81.05%), Query Frame = 1
BLAST of MELO3C004787 vs. NCBI nr
Match: gi|778670437|ref|XP_011649473.1| (PREDICTED: cytoplasmic tRNA 2-thiolation protein 1 [Cucumis sativus]) HSP 1 Score: 127.5 bits (319), Expect = 1.7e-26 Identity = 67/95 (70.53%), Postives = 76/95 (80.00%), Query Frame = 1
BLAST of MELO3C004787 vs. NCBI nr
Match: gi|1012342382|gb|KYP53576.1| (Cytoplasmic tRNA 2-thiolation protein 1 [Cajanus cajan]) HSP 1 Score: 126.7 bits (317), Expect = 2.9e-26 Identity = 67/115 (58.26%), Postives = 83/115 (72.17%), Query Frame = 1
BLAST of MELO3C004787 vs. NCBI nr
Match: gi|1009151299|ref|XP_015893480.1| (PREDICTED: cytoplasmic tRNA 2-thiolation protein 1 [Ziziphus jujuba]) HSP 1 Score: 126.7 bits (317), Expect = 2.9e-26 Identity = 62/74 (83.78%), Postives = 69/74 (93.24%), Query Frame = 1
BLAST of MELO3C004787 vs. NCBI nr
Match: gi|659089053|ref|XP_008445303.1| (PREDICTED: cytoplasmic tRNA 2-thiolation protein 1 [Cucumis melo]) HSP 1 Score: 125.2 bits (313), Expect = 8.5e-26 Identity = 66/95 (69.47%), Postives = 75/95 (78.95%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following transcribed_cluster feature(s) are associated with this gene:
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|